KEGG   Rousettus aegyptiacus (Egyptian rousette): 107517786
Entry
107517786         CDS       T06036                                 

Gene name
CXCL12
Definition
(RefSeq) stromal cell-derived factor 1 isoform X1
  KO
K10031  C-X-C motif chemokine 12
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04061  Viral protein interaction with cytokine and cytokine receptor
ray04062  Chemokine signaling pathway
ray04064  NF-kappa B signaling pathway
ray04360  Axon guidance
ray04670  Leukocyte transendothelial migration
ray04672  Intestinal immune network for IgA production
ray04810  Regulation of actin cytoskeleton
ray05163  Human cytomegalovirus infection
ray05200  Pathways in cancer
ray05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    107517786 (CXCL12)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107517786 (CXCL12)
   04061 Viral protein interaction with cytokine and cytokine receptor
    107517786 (CXCL12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107517786 (CXCL12)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107517786 (CXCL12)
   04672 Intestinal immune network for IgA production
    107517786 (CXCL12)
   04062 Chemokine signaling pathway
    107517786 (CXCL12)
  09158 Development and regeneration
   04360 Axon guidance
    107517786 (CXCL12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107517786 (CXCL12)
  09163 Immune disease
   05323 Rheumatoid arthritis
    107517786 (CXCL12)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107517786 (CXCL12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107517786 (CXCL12)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107517786 (CXCL12)
Cytokines and growth factors [BR:ray04052]
 Cytokines
  Chemokines
   107517786 (CXCL12)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Chemokines
   107517786 (CXCL12)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 107517786
NCBI-ProteinID: XP_016014399
LinkDB
Position
Unknown
AA seq 140 aa
MDAKVVVVLALVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIV
ARLKNNNRQVCIDPKLKWIQEYLEKALNKGRREEKVGKKRKDRKKEATEEEKGCSEKKKL
VIYHLEMDRSALCSCLSRAL
NT seq 423 nt   +upstreamnt  +downstreamnt
atggatgccaaggttgtcgtcgtgctggccctcgtgctgactgcgctctgcctcagcgac
ggaaaaccagtcagcctgagctacagatgtccttgtcgattcttcgagagccacgttgcc
agggccaatgtcaagcatctcaaaatcctcaacactccaaactgtgcccttcagattgtg
gcaaggctgaagaataacaacagacaagtgtgcattgacccaaaattgaagtggattcag
gaatacctggagaaagctttaaacaaggggcgcagagaagaaaaagtggggaaaaaaaga
aaagataggaaaaaagaagcgacagaagaagagaaaggctgctcagaaaagaaaaaacta
gttatctaccacctcgagatggaccgcagtgcactctgctcttgtctctcccgtgctttg
taa

DBGET integrated database retrieval system