KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108526412
Entry
108526412         CDS       T04641                                 

Gene name
BCL2
Definition
(RefSeq) BCL2, apoptosis regulator
  KO
K02161  apoptosis regulator Bcl-2
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01521  EGFR tyrosine kinase inhibitor resistance
rbb01522  Endocrine resistance
rbb01524  Platinum drug resistance
rbb04064  NF-kappa B signaling pathway
rbb04066  HIF-1 signaling pathway
rbb04071  Sphingolipid signaling pathway
rbb04115  p53 signaling pathway
rbb04140  Autophagy - animal
rbb04141  Protein processing in endoplasmic reticulum
rbb04151  PI3K-Akt signaling pathway
rbb04210  Apoptosis
rbb04215  Apoptosis - multiple species
rbb04217  Necroptosis
rbb04261  Adrenergic signaling in cardiomyocytes
rbb04340  Hedgehog signaling pathway
rbb04510  Focal adhesion
rbb04621  NOD-like receptor signaling pathway
rbb04630  JAK-STAT signaling pathway
rbb04722  Neurotrophin signaling pathway
rbb04725  Cholinergic synapse
rbb04915  Estrogen signaling pathway
rbb04928  Parathyroid hormone synthesis, secretion and action
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb05014  Amyotrophic lateral sclerosis
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05132  Salmonella infection
rbb05145  Toxoplasmosis
rbb05152  Tuberculosis
rbb05161  Hepatitis B
rbb05162  Measles
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
rbb05206  MicroRNAs in cancer
rbb05210  Colorectal cancer
rbb05215  Prostate cancer
rbb05222  Small cell lung cancer
rbb05226  Gastric cancer
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108526412 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    108526412 (BCL2)
   04630 JAK-STAT signaling pathway
    108526412 (BCL2)
   04064 NF-kappa B signaling pathway
    108526412 (BCL2)
   04066 HIF-1 signaling pathway
    108526412 (BCL2)
   04071 Sphingolipid signaling pathway
    108526412 (BCL2)
   04151 PI3K-Akt signaling pathway
    108526412 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108526412 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    108526412 (BCL2)
   04215 Apoptosis - multiple species
    108526412 (BCL2)
   04217 Necroptosis
    108526412 (BCL2)
   04115 p53 signaling pathway
    108526412 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108526412 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    108526412 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    108526412 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    108526412 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108526412 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    108526412 (BCL2)
   04722 Neurotrophin signaling pathway
    108526412 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108526412 (BCL2)
   05206 MicroRNAs in cancer
    108526412 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108526412 (BCL2)
   05226 Gastric cancer
    108526412 (BCL2)
   05215 Prostate cancer
    108526412 (BCL2)
   05222 Small cell lung cancer
    108526412 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    108526412 (BCL2)
   05022 Pathways of neurodegeneration - multiple diseases
    108526412 (BCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108526412 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108526412 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108526412 (BCL2)
   05152 Tuberculosis
    108526412 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108526412 (BCL2)
   05161 Hepatitis B
    108526412 (BCL2)
   05162 Measles
    108526412 (BCL2)
   05168 Herpes simplex virus 1 infection
    108526412 (BCL2)
   05169 Epstein-Barr virus infection
    108526412 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108526412 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108526412 (BCL2)
   01524 Platinum drug resistance
    108526412 (BCL2)
   01522 Endocrine resistance
    108526412 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rbb01009]
    108526412 (BCL2)
Protein phosphatases and associated proteins [BR:rbb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108526412 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 108526412
NCBI-ProteinID: XP_017722641
LinkDB
Position
Un
AA seq 244 aa
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAATPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLPTPAAPAAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWAAGQRPRKFVATSQYLIASLRGLLLISTERPFLAFKNKDESPRAR
NIKD
NT seq 735 nt   +upstreamnt  +downstreamnt
atggcgcacgctgggagaacagggtacgataaccgggagatagtgatgaagtacatccac
tataagctgtcgcagaggggctacgagtgggatgcgggagatgtgggcgccgcgacccct
ggggccgcccccgcaccgggcatcttctcctcccagcccgggcacacgccccatcccgcc
gcgtcccgggacccggtcgccaggacctcgccgctgccgaccccggctgcccccgccgcc
gccgcggggcctgcgctcagcccggtgccacctgtggtccacctgaccctccgccaggcc
ggtgacgacttctcccgccgctaccgccgcgacttcgccgagatgtccagccagctgcac
ctgacgcccttcaccgcgcggggacgctttgccacggtggtggaggagctcttcagggac
ggggtgaactgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggag
agcgtcaaccgggagatgtcgcccctggtggacaacatcgccctgtggatgactgagtac
ctgaaccggcacctgcacacttggatccaggataacggaggctgggcagcaggccagagg
ccacggaaattcgttgccacttcacagtatctcattgcatcattgagaggtttactcctg
atcagcaccgaaagaccatttttggcctttaaaaataaagatgaaagtccaagagccaga
aacattaaggattaa

DBGET integrated database retrieval system