KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108530341
Entry
108530341         CDS       T04641                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01522  Endocrine resistance
rbb04012  ErbB signaling pathway
rbb04066  HIF-1 signaling pathway
rbb04068  FoxO signaling pathway
rbb04110  Cell cycle
rbb04151  PI3K-Akt signaling pathway
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04934  Cushing syndrome
rbb05162  Measles
rbb05165  Human papillomavirus infection
rbb05169  Epstein-Barr virus infection
rbb05200  Pathways in cancer
rbb05202  Transcriptional misregulation in cancer
rbb05203  Viral carcinogenesis
rbb05206  MicroRNAs in cancer
rbb05215  Prostate cancer
rbb05220  Chronic myeloid leukemia
rbb05222  Small cell lung cancer
rbb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108530341 (CDKN1B)
   04066 HIF-1 signaling pathway
    108530341 (CDKN1B)
   04068 FoxO signaling pathway
    108530341 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    108530341 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108530341 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108530341 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    108530341 (CDKN1B)
   05206 MicroRNAs in cancer
    108530341 (CDKN1B)
   05203 Viral carcinogenesis
    108530341 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    108530341 (CDKN1B)
   05220 Chronic myeloid leukemia
    108530341 (CDKN1B)
   05215 Prostate cancer
    108530341 (CDKN1B)
   05222 Small cell lung cancer
    108530341 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108530341 (CDKN1B)
   04934 Cushing syndrome
    108530341 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    108530341 (CDKN1B)
   05169 Epstein-Barr virus infection
    108530341 (CDKN1B)
   05165 Human papillomavirus infection
    108530341 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108530341 (CDKN1B)
SSDB
Motif
Pfam: CDI Multi-haem_cyto
Other DBs
NCBI-GeneID: 108530341
NCBI-ProteinID: XP_017728637
UniProt: A0A2K6JPH5
LinkDB
Position
Un
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKW
NFDFQNHRPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIG
APANPEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagccctagcctagagcggatggacgccaggcag
gcggagcaccccaagccctcggcctgcaggaacctcttcggcccggtggaccacgaagag
ttaacccgggacttggagaagcactgcagagacatggaagaggcgagccagcgcaagtgg
aatttcgattttcagaatcacagacccctagagggcaagtacgagtggcaggaggtggag
aagggcagcttgcctgagttctactatagacccccgcggccccccaaaggcgcctgcaag
gtgccggcgcaggagagccaggatgtcagcgggagccgcccggcggcgcctttaattggg
gctccggctaaccctgaggacacgcatttggtagacccaaagactgatccgtcggacagc
cagacggggttagcggagcagtgcgcaggaataaggaagcgacctgcaaccgacgattct
tccactcaaaacaaaagagccaacagaacagaagaaaatgtttcagacggttccccaaat
gccggttctgtggagcagacgcccaagaagcctggcctcagaagacgacaaacgtaa

DBGET integrated database retrieval system