KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108542424
Entry
108542424         CDS       T04641                                 

Gene name
MAX
Definition
(RefSeq) MYC associated factor X
  KO
K04453  Max protein
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04010  MAPK signaling pathway
rbb05200  Pathways in cancer
rbb05202  Transcriptional misregulation in cancer
rbb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108542424 (MAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108542424 (MAX)
   05202 Transcriptional misregulation in cancer
    108542424 (MAX)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108542424 (MAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rbb03000]
    108542424 (MAX)
Transcription factors [BR:rbb03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Mad/Max
    108542424 (MAX)
SSDB
Motif
Pfam: HLH DUF5716 Filament Jnk-SapK_ap_N SlyX bZIP_2 DUF5595 ZapB DUF4763 Csm1_N ATG16 TFIIA V_ATPase_I
Other DBs
NCBI-GeneID: 108542424
NCBI-ProteinID: XP_017747921
UniProt: A0A2K6MX18
LinkDB
Position
Un
AA seq 162 aa
MRPTNDDIEVGRGDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKA
SRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSS
DNSLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS
NT seq 489 nt   +upstreamnt  +downstreamnt
atgaggccgactaacgatgacatcgaggtcggaagaggcgacgaagagcaaccgaggttt
caatctgcggctgacaaacgggctcatcataatgcactggaacgaaaacgtagggaccac
atcaaagacagctttcacagtttgcgggactcagtcccatcactccaaggagagaaggca
tcccgggcccaaatcctagacaaagccacagagtatatccagtatatgcgaaggaaaaac
cacacacaccagcaagatattgacgacctcaagcggcagaatgctcttctggagcagcaa
gtccgtgcactggagaaggcgaggtcaagtgcccaactgcagaccaactacccctcctca
gacaacagcctctacaccaacgccaagggcagcaccatctctgccttcgatgggggctca
gactccagctcggagtctgagcctgaagagccccaaagcaggaagaagctccggatggag
gccagctaa

DBGET integrated database retrieval system