KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108543462
Entry
108543462         CDS       T04641                                 

Gene name
APAF1
Definition
(RefSeq) apoptotic peptidase activating factor 1
  KO
K02084  apoptotic protease-activating factor
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01524  Platinum drug resistance
rbb04115  p53 signaling pathway
rbb04210  Apoptosis
rbb04215  Apoptosis - multiple species
rbb05010  Alzheimer disease
rbb05012  Parkinson disease
rbb05014  Amyotrophic lateral sclerosis
rbb05016  Huntington disease
rbb05020  Prion disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05134  Legionellosis
rbb05152  Tuberculosis
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05162  Measles
rbb05164  Influenza A
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05200  Pathways in cancer
rbb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108543462 (APAF1)
   04215 Apoptosis - multiple species
    108543462 (APAF1)
   04115 p53 signaling pathway
    108543462 (APAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108543462 (APAF1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108543462 (APAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108543462 (APAF1)
   05012 Parkinson disease
    108543462 (APAF1)
   05014 Amyotrophic lateral sclerosis
    108543462 (APAF1)
   05016 Huntington disease
    108543462 (APAF1)
   05020 Prion disease
    108543462 (APAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    108543462 (APAF1)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    108543462 (APAF1)
   05152 Tuberculosis
    108543462 (APAF1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    108543462 (APAF1)
   05160 Hepatitis C
    108543462 (APAF1)
   05164 Influenza A
    108543462 (APAF1)
   05162 Measles
    108543462 (APAF1)
   05168 Herpes simplex virus 1 infection
    108543462 (APAF1)
   05169 Epstein-Barr virus infection
    108543462 (APAF1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108543462 (APAF1)
SSDB
Motif
Pfam: NB-ARC WD40 APAF1_C ANAPC4_WD40 CARD Ge1_WD40 WD40_like eIF2A CARD_2 AAA_16 Utp8 Nbas_N AAA_22 NACHT
Other DBs
NCBI-GeneID: 108543462
NCBI-ProteinID: XP_017749445
LinkDB
Position
Un
AA seq 1218 aa
MDAKARNCLLQHREALEKDIKTSYIMDHMISDGFLTISEEEKVRNEPTQQQRAAMLIKMI
LKKDNDSYISFYNALLHEGYKDLAALLHDGIPVVSSSSGKDSVSGITSYVRTVLCEGGVP
QRPVVFVTRKKLVNAIQQKLSKLKGEPGWVTIHGMAGCGKSVLAAEAVRDHSLLEDCFPG
GVHWVSVGKQDKSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSLL
ILDDVWDSWVLKAFDNQCQILLTTRDKSVTDSVMGPKYVVPVESSLGKEKGLEILSLFVN
MKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLKQLQNKQFKRIRKSSSYD
YEALDEAMSISVEMLREDIKYYYTDLSILQKDVKVPTKVLCILWDMETEEVEDILQEFVN
KSLLFCDRNGKSFRYYLHDLQVDFLTEKNCSQLQVLESCAADVTFFLKELCALMFSLDWI
KAKTELVGPAHLIHEFVEYRHILDEKDCAVSENFQEFLSLNGHLLGRQPFPNIVQLGLCE
PETSEVYQQAKLQAKQEVDNGMLYLEWINKKNITNLSRLVVRPHTDAVYHACFSEDGQRI
ASCGADKTLQVFKAETGEKLLEIKAHEDEVLCCAFSTDDRFIATCSVDKKVKIWNAVTGE
LVHTYDEHSEQVNCCHFTNSSHHLLLATGSNDCFLKLWDLNQKECRNTMFGHTDSVNHCR
FSPDDKLLASCSADGTLKLWDVTSANERKSFNVKQFFLNSEDPQEDMEVIVKCCSWFADG
ARIMVAAKNKIFLFDIHTSGLLGEIHTGHHSTIQYCDFSPQNHLAVVALSQYCVELWNID
SCSKVADCRGHLSWVHGVKFSPDGSSFLTSSDDQTIRLWETKKVCKNSAIMLKQEVDVVF
QENEVMVLAVDHIRRLQLINGKTGQIDYLTEAQVSCCCLSPHLQYIAFGDENGTIEILEL
VNNRIFQSRIRHKKTVWHIQFTADEKTLISSSDDSAIQVWNWQLEEYVFLQAHQETVKDF
RLLKNSRLLSWSFDGTVKVWNIITGKXEKDFVCHQGTVLSCDISHDTTKFSSTSADKTAK
IWSFDLLLPLHELRGHNGCVRCSAFSVDSTLLATGDDNGEIRIWNVSNGELLHLCAPLSE
EGAATHGGWVTDLCFSPDGKMLISAGGYIKWWNVVTGESSQTFYTNGTNLKKIHVSPDFK
TYVTVDNLGILYILQTLE
NT seq 3657 nt   +upstreamnt  +downstreamnt
atggatgcaaaagctcgaaattgtttgcttcaacatagagaagctctggaaaaggacatc
aagacatcctacatcatggatcatatgattagtgatggatttttaacaatatcagaagag
gaaaaagtaagaaatgagcccactcaacagcaaagagcagctatgctaattaaaatgata
cttaaaaaagataatgattcctacatatcattctacaatgctctactacatgaaggatat
aaagatcttgctgcccttctccatgatggcattcctgttgtctcttcttccagtggtaaa
gattcagttagtggaataacttcatatgtaaggacagtcctgtgtgaaggtggagtacca
cagaggccagttgtttttgtcacaaggaagaagctggtgaatgcaattcagcagaagctc
tccaaattgaagggtgaaccaggatgggtcaccatacatggaatggcaggctgtggaaag
tctgtattggctgcagaagctgttagagatcattccctcttagaagattgtttcccaggg
ggagtgcattgggtttcagttgggaaacaagacaaatctggacttctgatgaaactgcag
aatctttgcacacgattggatcaagatgagagtttttcccagaggcttccacttaatatt
gaagaggctaaagaccgtcttcgcattctgatgcttcgcaaacacccaaggtctctgttg
atcttggatgatgtttgggactcttgggtgttgaaggcttttgacaatcagtgtcagatt
cttcttacaaccagagacaagagtgttacagattcagtaatgggtcctaaatatgtagtc
cctgtggagagttccttaggaaaagaaaaaggacttgaaattttatccctttttgttaat
atgaagaaagcagatttgccagaacaagctcatagtattataaaagaatgtaaaggctct
ccccttgtagtatctttaattggtgcacttttacgtgattttcccaatcgctgggagtac
tacctcaaacaacttcagaataagcagtttaagagaataaggaaatcttcgtcttatgat
tatgaggctctagatgaagccatgtctataagtgttgaaatgctcagagaagacatcaaa
tattattacacagatctttccatccttcagaaggacgttaaggtgcctacaaaggtgtta
tgtattctctgggacatggaaactgaagaagttgaagacatactgcaggagtttgtaaat
aagtctcttttattttgtgatcggaatggaaagtcgtttcgttattatttacatgatctt
caagtagattttcttacagagaagaattgcagccagcttcaggtacttgaatcttgtgct
gctgatgttactttttttttaaaggaactttgtgctttaatgttttccctggattggatt
aaagcaaaaacagaacttgtaggccctgctcatctgattcatgaatttgtggaatacaga
catatactagatgaaaaggattgtgcagtcagtgagaattttcaggagtttttatcttta
aatggacaccttcttggacgacagccatttcctaatattgtacaactgggtctctgtgag
ccggaaacttcagaagtttatcagcaagctaagctgcaggccaagcaggaggtcgataat
ggaatgctttacctggaatggataaacaaaaaaaacatcacgaatctttcccgcttagtt
gtccgcccccacacagatgctgtttaccatgcctgcttttctgaggatggtcagagaata
gcttcttgtggagctgataaaaccttacaggtgttcaaagctgaaacaggagagaaactt
ttagaaatcaaggctcatgaggacgaagtgctttgttgtgcattctctacagatgacaga
tttatagcaacctgctcagtggataaaaaagtgaagatttggaatgctgtgaccggggaa
ctagtacacacctatgatgagcactcagagcaagtcaattgctgccatttcaccaacagt
agtcatcatcttctcttagccactgggtcaaatgactgcttcctcaaactctgggatttg
aatcaaaaagaatgtcgaaataccatgtttggtcatacagattcagttaatcactgcaga
ttttcaccagatgataagcttttggctagttgctcagctgatggaaccttaaagctttgg
gatgtgacatcagcaaacgagaggaaaagctttaatgtgaaacagttcttcctaaattca
gaggaccctcaagaggatatggaagtgatagtgaagtgttgttcgtggtttgctgatggt
gcaaggataatggtggcagcaaaaaataaaatctttctttttgacattcataccagtggc
ctattgggagaaatccacacgggccatcacagcaccatccagtactgtgacttctccccg
caaaaccatttggcagtggttgctttgtcccagtactgtgtagagttgtggaatatagac
tcatgttcaaaggtggctgattgcagaggacatttaagttgggttcatggtgtgaagttt
tctcctgatggatcatcatttttgacatcttctgatgaccagacaattaggctctgggag
acaaagaaagtatgtaagaactctgctataatgttaaagcaagaagtagatgttgtgttt
caagaaaatgaagtgatggtccttgcagttgaccatataagacgtctgcaactcattaat
ggaaaaacaggtcagattgattatctgactgaagctcaagttagctgctgttgcttaagt
ccgcatcttcaatacattgcatttggagacgaaaatggaaccattgagattttagaactt
gtaaacaatagaatcttccaatccaggattcggcacaagaaaactgtatggcacatccag
ttcacagccgatgagaagacacttatttcaagttctgatgattctgcaattcaggtatgg
aattggcagttggaggaatatgtctttctacaagcccatcaggaaacagtgaaagacttt
agactcttgaaaaattcaagactgctttcttggtcatttgatggaacagtgaaggtatgg
aatataattactggaaaantagaaaaagactttgtctgtcaccagggtacagtactttct
tgtgacatttctcatgatactaccaagttttcgtctacctctgctgacaagactgcaaag
atctggagttttgatctccttttgccacttcatgaattgaggggccacaacggctgtgtg
cgctgctctgccttctctgtggacagtaccctgctggcaacgggagatgacaatggagaa
atcaggatatggaatgtctcaaacggtgagcttcttcacttgtgtgctccgctttcagaa
gaaggagctgctacccatggaggctgggtgactgacctttgcttttctccagatggcaaa
atgcttatctctgctggaggatatattaagtggtggaacgttgtcactggggaatcctca
cagaccttctacacaaatggaaccaatcttaagaaaatacatgtgtcccctgacttcaaa
acatatgtgactgtggataatcttggtattttatatattttacagactttagaataa

DBGET integrated database retrieval system