KEGG   Rattus norvegicus (rat): 24239
Entry
24239             CDS       T01003                                 

Gene name
Cacna1c, RATIVS302
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04260  Cardiac muscle contraction
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04713  Circadian entrainment
rno04720  Long-term potentiation
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04727  GABAergic synapse
rno04728  Dopaminergic synapse
rno04742  Taste transduction
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04921  Oxytocin signaling pathway
rno04924  Renin secretion
rno04925  Aldosterone synthesis and secretion
rno04927  Cortisol synthesis and secretion
rno04929  GnRH secretion
rno04930  Type II diabetes mellitus
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno05010  Alzheimer disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05031  Amphetamine addiction
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24239 (Cacna1c)
   04020 Calcium signaling pathway
    24239 (Cacna1c)
   04024 cAMP signaling pathway
    24239 (Cacna1c)
   04022 cGMP-PKG signaling pathway
    24239 (Cacna1c)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    24239 (Cacna1c)
   04929 GnRH secretion
    24239 (Cacna1c)
   04912 GnRH signaling pathway
    24239 (Cacna1c)
   04921 Oxytocin signaling pathway
    24239 (Cacna1c)
   04935 Growth hormone synthesis, secretion and action
    24239 (Cacna1c)
   04924 Renin secretion
    24239 (Cacna1c)
   04925 Aldosterone synthesis and secretion
    24239 (Cacna1c)
   04927 Cortisol synthesis and secretion
    24239 (Cacna1c)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    24239 (Cacna1c)
   04261 Adrenergic signaling in cardiomyocytes
    24239 (Cacna1c)
   04270 Vascular smooth muscle contraction
    24239 (Cacna1c)
  09156 Nervous system
   04724 Glutamatergic synapse
    24239 (Cacna1c)
   04727 GABAergic synapse
    24239 (Cacna1c)
   04725 Cholinergic synapse
    24239 (Cacna1c)
   04728 Dopaminergic synapse
    24239 (Cacna1c)
   04726 Serotonergic synapse
    24239 (Cacna1c)
   04720 Long-term potentiation
    24239 (Cacna1c)
   04723 Retrograde endocannabinoid signaling
    24239 (Cacna1c)
  09157 Sensory system
   04742 Taste transduction
    24239 (Cacna1c)
  09159 Environmental adaptation
   04713 Circadian entrainment
    24239 (Cacna1c)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    24239 (Cacna1c)
   05020 Prion disease
    24239 (Cacna1c)
   05022 Pathways of neurodegeneration - multiple diseases
    24239 (Cacna1c)
  09165 Substance dependence
   05031 Amphetamine addiction
    24239 (Cacna1c)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    24239 (Cacna1c)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    24239 (Cacna1c)
   05414 Dilated cardiomyopathy
    24239 (Cacna1c)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    24239 (Cacna1c)
   04934 Cushing syndrome
    24239 (Cacna1c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    24239 (Cacna1c)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   24239 (Cacna1c)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel Etmic-2 DUF4834
Other DBs
NCBI-GeneID: 24239
NCBI-ProteinID: NP_036649
RGD: 2245
Ensembl: ENSRNOG00000007090
UniProt: P22002 Q71QJ6 A0SLC4
LinkDB
Structure
PDB: 
1VYT

Position
4q42
AA seq 2170 aa
MIRAFAQPSTPPYQPLSSCLSEDTERKFKGKVVHEAQLNCFYISPGGSNYGSPRPAHANM
NANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGGTTATRPPRALLCLTLKNPIRRACISIVEWKSFEIIILLTIFANCVALAIYIPFPED
DSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSA
ILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIIDVPAEEDPSPCALETGHGRQCQNGT
VCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVI
FGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEDKPRNMSMPTSETESVNTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWN
RFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTAE
MLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKI
TRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFD
NFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLA
IAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEVMEKPAVEESKEEKIELKSIT
ADGESPPTTKINMDDLQPSENEDKSPHSNPDTAGEEDEEEPEMPVGPRPRPLSELHLKEK
AVPMPEASAFFIFSPNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRN
HILFYFDIVFTTIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSA
INVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQL
FKGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFT
VSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQ
EQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLIL
LNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKHYFCDAWNTFDALI
VVGSIVDIAITEVHPAEHTQCSPSMSAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLL
WTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLF
RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL
FVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGF
GKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIK
KIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALS
LQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYY
QSDSRSNFPQTFATQRPLHINKTGNNQADTESPSHEKLVDSTFTPSSYSSTGSNANINNA
NNTALGRFPHPAGYSSTVSTVEGHGPPLSPAVRVQEAAWKLSSKRCHSRESQGATVSQDM
FPDETRSSVRLSEEVEYCSEPSLLSTDILSYQDDENRQLTCLEEDKREIQPSPKRSFLRS
ASLGRRASFHLECLKRQKDQGGDISQKTALPLHLVHHQALAVAGLSPLLQRSHSPSTFPR
PRPTPPVTPGSRGRPLQPIPTLRLEGAESSEKLNSSFPSIHCSSWSEETTACSGGSSMAR
RARPVSLTVPSQAGAPGRQFHGSASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDM
TIEEMENAADNILSGGAQQSPNGTLLPFVNCRDPGQDRAVVPEDESCVYALGRGRSEEAL
PDSRSYVSNL
NT seq 6513 nt   +upstreamnt  +downstreamnt
atgattcgggccttcgctcagccatccacacccccataccagccgctctccagttgcctg
tctgaggacacagagaggaagttcaagggcaaggtggtacacgaagctcaactcaactgt
ttctacatttctcctggaggttccaactatgggagcccacgcccagctcatgccaacatg
aatgccaatgcagctgcaggacttgcccccgagcacatccctactccaggggcagcactg
tcctggcaggcagccatcgatgccgcccggcaggccaagttaatgggcagtgctggcaat
gcgaccatctctaccgtcagttccacacagcggaagcggcagcagtatgggaaacccaag
aagcaggggggcacaactgccacacggccgccccgggctctgctctgcctgactctgaag
aaccccatcaggagggcatgcatcagcattgttgaatggaaatcatttgaaataattatt
ttattgacgatttttgccaattgtgtggccttagcaatctatattccctttccggaagat
gactccaacgccaccaactccaacctggaacgggtggagtatctcttcctcatcattttt
accgtggaagcatttttaaaagtgattgcctacggactactcttccaccccaacgcttac
ctccgcaacggttggaatttactagattttataatcgtggttgtagggctttttagtgca
attttagaacaagcaaccaaagctgacggggccaacgctctgggagggaaaggagcggga
ttcgatgtgaaggcactgagagctttccgtgtgcttcgtcccctgcggctggtgtctgga
gtcccaagtctccaggtggtcctgaactccatcatcaaggccatggtgcccctgctgcac
attgccctcctcgtgctcttcgtcatcatcatctatgccattatcggcctggagctcttc
atggggaagatgcacaagacctgctacaaccaggagggcataatagatgttccagcggaa
gaggatccctccccttgtgctttggagacaggccatgggcgacagtgtcagaacgggacc
gtgtgcaagcccgggtgggatgggcccaagcacggcatcaccaacttcgacaacttcgcc
ttcgccatgctgacggtgttccagtgtatcaccatggagggctggacagacgtgctgtac
tggatgcaagacgctatgggctatgagttgccctgggtgtattttgtcagtctggtcatc
tttggatcctttttcgttctaaatctggttctcggtgttttgagcggagagttttccaaa
gagagggagaaagccaaagctcgaggagacttccagaagcttcgtgagaagcagcagcta
gaagaagatctcaaaggctacctggactggatcacccaggcggaagacatagaccctgag
aatgaggacgagggcatggatgaagacaaaccccgaaacatgagcatgcccacaagtgag
actgagtctgtcaacaccgaaaacgtggctggaggtgacatcgagggtgaaaactgtgga
gcccggcttgcccaccggatctccaaatccaagttcagccgctactggcgccggtggaat
agattctgcagaagaaagtgccgtgccgcagttaagtccaatgtcttctactggctggtg
atcttcctggtgttcctcaacaccctcaccattgcctccgaacactacaaccagcctcat
tggctcacagaagtgcaagacacggccaacaaggccctcctggcccttttcacggcagaa
atgctcctgaagatgtacagcctgggtctgcaggcctactttgtatccctcttcaaccgc
tttgactgtttcattgtgtgcgggggcatcctggagaccatcctggtggagacgaagatc
atgtcgcccctgggcatctctgtgctgagatgtgtgcggctgctcaggattttcaagatc
accaggtactggaactccctgagcaacctcgtggcgtccttgctgaactcagtgcgctcc
atcgcctccctgctgctactcctcttcctcttcatcatcatcttctccctcctggggatg
cagctgtttggtggaaagttcaactttgatgagatgcagacccgtaggagcacgtttgat
aacttcccacagtctctcctcactgtgtttcagatcctgaccggggaggactggaattcg
gtgatgtatgatgggatcatggcttatggcggcccctcttttccagggatgttagtctgt
atttacttcatcatcctcttcatctgtggaaattatatcctactgaatgtgttcttggcc
attgcggtggacaacctggctgatgcggagagcctgacctctgcccaaaaagaggaagaa
gaagagaaggagagaaagaagctggccaggactgccagcccagaaaagaaacaggaggtg
atggagaaaccagcagtagaggagagcaaagaggagaaaattgagctgaagtccattaca
gcagatggagaatccccacccactaccaagatcaacatggatgacctccagcccagtgaa
aatgaggacaagagtccccactccaacccagacactgcaggtgaagaggatgaggaggag
cccgagatgcctgtgggcccacgcccccggcccctgtctgagctgcaccttaaggaaaag
gcagtccccatgccggaagccagtgcatttttcatcttcagcccaaacaacaggttccgc
ctgcagtgccaccgcattgtcaatgacacgatcttcaccaacctcatcctcttcttcatt
ctgctcagtagcatctccctggcggctgaggaccccgtccagcacacctccttcaggaac
cacattctgttttattttgacattgtttttaccaccattttcaccattgaaattgctcta
aagatgactgcttacggggctttcctgcacaagggctctttctgccgaaattacttcaat
atcctggacctgctggtggttagcgtgtccctcatctcctttggcattcagtccagcgcg
atcaacgttgtgaagattttaagagtgcttcgtgtcctcaggcccctgagggccatcaac
agggccaaggggctaaagcacgtcgttcagtgtgtgtttgtggccatccggaccattgga
aacattgtaattgtcaccactctgctgcagttcatgttcgcctgcattggggtccagctc
ttcaagggaaagctctatacctgttcggatagttccaaacagacggaggcagaatgcaag
ggtaactatataacatacaaagacggagaagttgaccaccccattatccagcctcgaagt
tgggagaacagcaagttcgactttgacaatgttctggcagccatgatggccctctttacc
gtctccaccttcgaggggtggccagagctgctgtaccgctccattgactcccacacagaa
gacaagggtcccatctacaactatcgtgtggagatctccatcttcttcatcatctacatc
atcatcattgccttcttcatgatgaacatcttcgtgggtttcgtcattgtcaccttccag
gagcagggggaacaagaatacaagaactgtgagctggacaagaaccagagacaatgtgtg
gaatatgccctcaaggcccgacccttgcgaaggtacatccccaagaaccagcaccagtac
aaagtgtggtacgtggtcaactccacctacttcgagtatctgatgttcgtcctcatcctg
ctcaacaccatctgcctggccatgcagcactacggccagagctgcctcttcaaaatcgcc
atgaatatactcaacatgcttttcactggcctcttcacggtggagatgatcctgaagctc
attgccttcaaacccaagcactatttctgtgatgcatggaatacatttgacgccttgatt
gttgtgggtagcattgttgatatagcaatcaccgaggtacacccagctgaacatacccaa
tgctctccctctatgagtgcagaggagaactcccgcatctccatcaccttcttccgcctc
ttccgggtcatgcgcctggtgaagctgctgagccgaggggaaggcatccggaccctgctg
tggaccttcatcaagtccttccaggccctgccctatgtggcccttttgattgtgatgctg
ttctttatctatgcagtgattgggatgcaggtatttgggaagattgccctgaatgacacc
acagagatcaatcggaacaacaacttccagacgttccctcaggctgtgctactgctcttc
aggtgcgccactggggaggcctggcaggatatcatgctagcctgtatgccaggcaagaag
tgtgctccagagtctgagcccagcaacagcacggaaggggagacaccctgtggcagcagt
ttcgctgtcttctacttcatcagcttctacatgctctgtgccttcctgatcatcaacctc
tttgtagctgttatcatggacaactttgactacctgactagggattggtctatccttggt
ccccatcacctggatgaattcaagagaatctgggccgaatatgaccctgaagccaagggt
cggatcaaacacttggatgtggtgaccctcctccgtcgaattcagcccccactgggtttt
gggaagttgtgtcctcaccgtgtggcctgcaaacgcctggtgtccatgaacatgcctctg
aacagtgatgggacggtcatgttcaatgctacactgtttgcccttgtcaggacagccctg
aggatcaaaacagaagggaacctagagcaagccaatgaggagctgagagccatcatcaag
aaaatctggaagaggaccagcatgaagctgttggaccaggtggtgccccctgcaggtgat
gacgaggtcacagtgggcaagttctatgccaccttcctgatccaagagtacttcaggaaa
ttcaagaagcgaaaagagcaggggctggtcggcaagccctcgcagaggaatgcactgtct
ctgcaggctggcttacgcaccttgcatgacattgggcctgagatccggagagccatctct
ggggatctgacggctgaggaggagctggacaaggctatgaaggaggcagtgtctgctgcc
tccgaagacgacatcttcaggagggctggaggcctgtttggcaaccacgtcagctactac
cagagtgacagcaggagcaacttccctcagacgtttgccacccaacgcccactgcacatc
aacaagacagggaacaaccaagcggacaccgaatcaccgtcccatgagaagctggtggac
tccactttcacccccagcagctactcatccacgggctccaatgccaacatcaacaatgcc
aacaacactgccctgggccgcttcccccaccctgctggctactccagcacggtcagcact
gtggagggccatgggcctcccttgtcccctgctgtccgggtacaggaggcagcatggaaa
ctcagctctaagaggtgccactcccgagagagccagggggccacggtgagtcaggatatg
tttccagatgagacccgcagcagcgtgaggctgagcgaagaagttgagtactgcagtgag
cccagcctgctctccacagatatactctcctaccaggacgatgaaaaccgacaactgacc
tgtctagaggaggacaagagggagatccagccatctccgaagaggagtttccttcgctct
gcctctctaggtcgaagggcctccttccatctggaatgtctaaagcgacaaaaggatcaa
gggggagacatctctcagaagacagccttgcccttgcatctggttcatcaccaggcattg
gcagtggcaggcttgagccccctcctgcagagaagccattctccttccacgttccccagg
ccacgccccacgccccctgtcactccaggcagccggggcaggcccctacagcccatccct
accctgcggctggagggggcggagtccagtgagaaactcaacagcagcttcccgtccatc
cactgcagctcctggtcagaggagaccacagcctgtagtgggggcagcagcatggcccgg
agagcccggcccgtctccctcaccgtgcccagccaggctggagctccaggcagacagttc
cacggcagcgccagcagcctggtggaagcggtcttgatttcagaaggactgggacagttt
gctcaagatcccaagttcatcgaggtcaccacacaggagctggctgacgcctgcgatatg
acaatagaggagatggagaacgccgcagacaacatcctcagcgggggcgcccagcagagc
cccaacggcaccctcttaccttttgtgaactgcagggacccagggcaggacagggctgtg
gtcccagaggacgagagctgtgtatatgccctggggcgaggccggagcgaggaagcgctc
ccggacagcaggtcctatgtcagcaacctgtag

DBGET integrated database retrieval system