KEGG   Rattus norvegicus (rat): 314856
Entry
314856            CDS       T01003                                 

Gene name
Mdm2
Definition
(RefSeq) MDM2 proto-oncogene
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno01524  Platinum drug resistance
rno04068  FoxO signaling pathway
rno04110  Cell cycle
rno04115  p53 signaling pathway
rno04120  Ubiquitin mediated proteolysis
rno04144  Endocytosis
rno04151  PI3K-Akt signaling pathway
rno04218  Cellular senescence
rno04625  C-type lectin receptor signaling pathway
rno04919  Thyroid hormone signaling pathway
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05203  Viral carcinogenesis
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05218  Melanoma
rno05219  Bladder cancer
rno05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    314856 (Mdm2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    314856 (Mdm2)
   04151 PI3K-Akt signaling pathway
    314856 (Mdm2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    314856 (Mdm2)
  09143 Cell growth and death
   04110 Cell cycle
    314856 (Mdm2)
   04115 p53 signaling pathway
    314856 (Mdm2)
   04218 Cellular senescence
    314856 (Mdm2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    314856 (Mdm2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    314856 (Mdm2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    314856 (Mdm2)
   05202 Transcriptional misregulation in cancer
    314856 (Mdm2)
   05206 MicroRNAs in cancer
    314856 (Mdm2)
   05205 Proteoglycans in cancer
    314856 (Mdm2)
   05203 Viral carcinogenesis
    314856 (Mdm2)
  09162 Cancer: specific types
   05214 Glioma
    314856 (Mdm2)
   05220 Chronic myeloid leukemia
    314856 (Mdm2)
   05218 Melanoma
    314856 (Mdm2)
   05219 Bladder cancer
    314856 (Mdm2)
   05215 Prostate cancer
    314856 (Mdm2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    314856 (Mdm2)
   05169 Epstein-Barr virus infection
    314856 (Mdm2)
   05165 Human papillomavirus infection
    314856 (Mdm2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    314856 (Mdm2)
   01522 Endocrine resistance
    314856 (Mdm2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    314856 (Mdm2)
   04121 Ubiquitin system [BR:rno04121]
    314856 (Mdm2)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     314856 (Mdm2)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    314856 (Mdm2)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    314856 (Mdm2)
SSDB
Motif
Pfam: zf-C3HC4_3 zf-RanBP SWIB zf-RING_2 DUF4194 zf-FPG_IleRS DUF1229
Other DBs
NCBI-GeneID: 314856
NCBI-ProteinID: NP_001101569
RGD: 1305332
Ensembl: ENSRNOG00000006304
UniProt: D3ZVH5
LinkDB
Position
7q22
AA seq 458 aa
MCNTNMSVSTEGAAGTSQIPASEQETLIIFYIGQYIMTKRLYDEKQQHIVYCSNDLLGDV
FGVPSFSVKEHRKIYAMIYRNLVVVSQQDSGTSPSESRCQPEGGSDLKDPVQASQEEKPS
SSDVVSRPSTSSRRRAISETEENTDELPGERQRKRHRALSFDESLGLCVLREICCERSSS
SEATDTPSHQDLDDGVSDHSADCLDQDSVSDQFSVEFEVESLDSEDYSLSDEGHELSDED
DEVYRVTVYQAGESDADSFEGDPEISLADYWKCTSCNEMNPPLPSHCNRCWTLRENWLPD
DKGKDKVEISEKAKLESSDQAEEGLDVPDGKKVTEDDAKESSAEDSEEKVAQMLLSQESD
DYSQPSTSSSIVYSSQESGKELKEDTQDKEESMESSFSLNAIEPCVICQGRPKNGCIVHG
KTGHLMSCFTCAKKLKKRNKPCPVCRQPIQMIVLTYFN
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgtgcaataccaacatgtctgtgtctaccgagggtgctgcaggcacctcacagattcca
gcgtcggaacaagagactctgattatattttatattggacagtatattatgactaaaaga
ttatatgatgagaagcagcagcacattgtgtattgctcaaatgatctcctaggagatgtg
ttcggagtcccaagtttctctgtgaaggagcacaggaaaatatatgcaatgatctacaga
aacttagtggttgtaagtcaacaagactctggaacatcgccgagtgagagcagatgtcag
cctgaaggtgggagtgacctgaaggaccccgtgcaagcatcacaagaagagaaaccttca
tcttctgatgtagtttctagaccatctacctcatctagaaggagagcaattagtgaaaca
gaagagaacacagatgaactacctggggaacgacagaggaagcgccacagagccctgtcc
tttgatgagagcctgggtctgtgtgtgctcagggagatatgctgtgaaagaagcagcagc
agcgaggccacagacaccccctcacatcaggatcttgatgatggcgtaagtgaccattct
gctgattgcctggatcaggattcagtttctgatcaattcagtgtagaatttgaagttgag
tctcttgactcagaagattacagcctgagtgatgaagggcatgagctctcagatgaggat
gatgaggtctatcgggtcacagtctatcaggcaggagaaagcgatgcagactcttttgag
ggagatcctgaaatttccttagctgactattggaaatgcacctcgtgcaatgaaatgaat
cctccccttccatcacactgcaacagatgttggacccttcgtgagaactggcttccagac
gataaggggaaagataaagtggaaatttctgaaaaagccaaactggaaagctcagatcag
gcagaagaaggcttagatgtgcctgatggcaaaaaagtgacagaggatgatgctaaggag
tcatctgctgaggatagcgaggaaaaagtggcccagatgctcctgtcacaggagagtgac
gactattcccagccgtcgacttccagtagcattgtttacagcagccaagaaagtggcaaa
gagttgaaggaggacacacaagacaaagaggaaagtatggaatccagcttctctctgaac
gccatcgagccatgtgtgatttgccaggggcggcctaaaaatggttgcattgttcacggc
aaaaccggacacctgatgtcatgtttcacgtgtgcaaagaagctaaagaagaggaataag
ccctgccccgtgtgcagacagccgatccaaatgattgtgctcacgtacttcaactag

DBGET integrated database retrieval system