KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104657551
Entry
104657551         CDS       T03989                                 

Gene name
NPPA
Definition
(RefSeq) natriuretic peptides A
  KO
K12334  natriuretic peptide A
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04066  HIF-1 signaling pathway
rro04270  Vascular smooth muscle contraction
rro04714  Thermogenesis
rro04921  Oxytocin signaling pathway
rro04923  Regulation of lipolysis in adipocytes
rro04924  Renin secretion
rro04925  Aldosterone synthesis and secretion
rro05143  African trypanosomiasis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    104657551 (NPPA)
   04024 cAMP signaling pathway
    104657551 (NPPA)
   04022 cGMP-PKG signaling pathway
    104657551 (NPPA)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    104657551 (NPPA)
   04921 Oxytocin signaling pathway
    104657551 (NPPA)
   04924 Renin secretion
    104657551 (NPPA)
   04925 Aldosterone synthesis and secretion
    104657551 (NPPA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104657551 (NPPA)
  09159 Environmental adaptation
   04714 Thermogenesis
    104657551 (NPPA)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05143 African trypanosomiasis
    104657551 (NPPA)
SSDB
Motif
Pfam: ANP
Other DBs
NCBI-GeneID: 104657551
NCBI-ProteinID: XP_010355675
UniProt: A0A2K6NZ81
LinkDB
Position
12
AA seq 153 aa
MSSFSTISVSFLLFLAFQLPGQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPP
QVLSEQNEEAGAALSPLPEVPPWTGNVSPAQRDGGALGQGPWDSSDRSALLKSKLRALLT
APRSLRRSSCFGGRMDRIGAQSGLGCNSFRYRR
NT seq 462 nt   +upstreamnt  +downstreamnt
atgagctccttctccaccatcagtgtgagcttcctcctttttctggcattccagctccca
ggtcagaccagagctaatcccatgtacaatgccgtgtccaacgcagacctgatggatttc
aagaatttgctggaccatttggaagaaaagatgcctttagaagatgaggtcgtgccccca
caagtgctcagtgagcagaatgaagaagcgggggctgctctcagccccctccctgaggtg
cctccctggactgggaacgtcagcccagcccagagagatgggggtgccctcgggcagggc
ccctgggactcctccgatcgatctgccctcttaaaaagcaagctgagggcgctgctcact
gcccctcggagcctgcggagatccagttgtttcgggggcaggatggacaggattggagcc
cagagcggactgggctgtaacagcttccggtaccgaagataa

DBGET integrated database retrieval system