KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104661662
Entry
104661662         CDS       T03989                                 

Gene name
TP53
Definition
(RefSeq) cellular tumor antigen p53
  KO
K04451  tumor protein p53
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01522  Endocrine resistance
rro01524  Platinum drug resistance
rro04010  MAPK signaling pathway
rro04071  Sphingolipid signaling pathway
rro04110  Cell cycle
rro04115  p53 signaling pathway
rro04137  Mitophagy - animal
rro04151  PI3K-Akt signaling pathway
rro04210  Apoptosis
rro04211  Longevity regulating pathway
rro04216  Ferroptosis
rro04218  Cellular senescence
rro04310  Wnt signaling pathway
rro04722  Neurotrophin signaling pathway
rro04919  Thyroid hormone signaling pathway
rro05012  Parkinson disease
rro05014  Amyotrophic lateral sclerosis
rro05016  Huntington disease
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
rro05203  Viral carcinogenesis
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05210  Colorectal cancer
rro05212  Pancreatic cancer
rro05213  Endometrial cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05216  Thyroid cancer
rro05217  Basal cell carcinoma
rro05218  Melanoma
rro05219  Bladder cancer
rro05220  Chronic myeloid leukemia
rro05222  Small cell lung cancer
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
rro05230  Central carbon metabolism in cancer
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104661662 (TP53)
   04310 Wnt signaling pathway
    104661662 (TP53)
   04071 Sphingolipid signaling pathway
    104661662 (TP53)
   04151 PI3K-Akt signaling pathway
    104661662 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    104661662 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    104661662 (TP53)
   04210 Apoptosis
    104661662 (TP53)
   04216 Ferroptosis
    104661662 (TP53)
   04115 p53 signaling pathway
    104661662 (TP53)
   04218 Cellular senescence
    104661662 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    104661662 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    104661662 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    104661662 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104661662 (TP53)
   05202 Transcriptional misregulation in cancer
    104661662 (TP53)
   05206 MicroRNAs in cancer
    104661662 (TP53)
   05205 Proteoglycans in cancer
    104661662 (TP53)
   05203 Viral carcinogenesis
    104661662 (TP53)
   05230 Central carbon metabolism in cancer
    104661662 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104661662 (TP53)
   05212 Pancreatic cancer
    104661662 (TP53)
   05225 Hepatocellular carcinoma
    104661662 (TP53)
   05226 Gastric cancer
    104661662 (TP53)
   05214 Glioma
    104661662 (TP53)
   05216 Thyroid cancer
    104661662 (TP53)
   05220 Chronic myeloid leukemia
    104661662 (TP53)
   05217 Basal cell carcinoma
    104661662 (TP53)
   05218 Melanoma
    104661662 (TP53)
   05219 Bladder cancer
    104661662 (TP53)
   05215 Prostate cancer
    104661662 (TP53)
   05213 Endometrial cancer
    104661662 (TP53)
   05224 Breast cancer
    104661662 (TP53)
   05222 Small cell lung cancer
    104661662 (TP53)
   05223 Non-small cell lung cancer
    104661662 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    104661662 (TP53)
   05014 Amyotrophic lateral sclerosis
    104661662 (TP53)
   05016 Huntington disease
    104661662 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104661662 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104661662 (TP53)
   05161 Hepatitis B
    104661662 (TP53)
   05160 Hepatitis C
    104661662 (TP53)
   05162 Measles
    104661662 (TP53)
   05168 Herpes simplex virus 1 infection
    104661662 (TP53)
   05163 Human cytomegalovirus infection
    104661662 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104661662 (TP53)
   05169 Epstein-Barr virus infection
    104661662 (TP53)
   05165 Human papillomavirus infection
    104661662 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    104661662 (TP53)
   01522 Endocrine resistance
    104661662 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104661662 (TP53)
   03036 Chromosome and associated proteins [BR:rro03036]
    104661662 (TP53)
   03400 DNA repair and recombination proteins [BR:rro03400]
    104661662 (TP53)
Transcription factors [BR:rro03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    104661662 (TP53)
Chromosome and associated proteins [BR:rro03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     104661662 (TP53)
DNA repair and recombination proteins [BR:rro03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    104661662 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer TAD2 P53_TAD
Other DBs
NCBI-GeneID: 104661662
NCBI-ProteinID: XP_010360689
UniProt: A0A2K6QDI6
LinkDB
Position
19
AA seq 393 aa
MEEPQSDPSIEPPLSQETFSDLWKLLPENNVLSPLPSQAVDDLMLSPDDLAQWLTEDPGP
DEAPRMSEAAPPMAPTPAAPTPAAPAPAPSWPLSSSVPSQKTYHGSYGFRLGFLHSGTAK
SVTCTYSPDLNKMFCQLAKTCPVQLWVDSTPPPGSRVRAMAIYKQSQHMTEVVRRCPHHE
RCSDSDGLAPPQHLIRVEGNLRVEYSDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS
SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENYRKKGEPCHELP
PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPA
GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggaggagccacagtcagatcctagcatcgagccccctctgagtcaggaaacattttca
gacctttggaaactacttcctgaaaacaacgttctgtcccccttgccgtcccaagcggtg
gatgacttgatgctgtctccggacgatcttgcacaatggttaactgaagacccaggtcca
gatgaagctcccagaatgtcagaggctgctccccccatggcccccacaccagcagctcct
acaccggcagcccctgcaccagccccctcctggcccctgtcatcctctgtcccttcccag
aaaacctaccatggcagctatggtttccgtctgggcttcctgcattctggaacagccaag
tctgtgacttgcacgtactcccctgacctcaacaagatgttttgccagctggccaagacc
tgtcctgtgcagctgtgggttgattccacacccccgcccggcagccgcgttcgtgccatg
gccatctacaagcagtcacagcacatgacggaggtcgtgaggcgctgcccccaccatgag
cgctgctcagacagcgatggactggcccctcctcagcatcttatccgagtggaaggaaat
ttgcgtgtggagtattcggatgacagaaacacttttcgacatagtgtggtggtgccctat
gagccgcctgaggttggctctgactgtaccaccatccactacaactacatgtgtaacagt
tcctgcatgggcggcatgaatcggaggcccattctcaccatcatcacactggaagactcc
agtggtaatctactgggacggaacagctttgaggtgcgagtttgtgcctgtcctgggaga
gaccggcgcacagaggaagagaattaccgcaagaaaggggagccttgccacgagctgccc
cctgggagcactaagcgagcactgcccaacaacaccagctcctctccgcagccaaagaag
aaaccactggatggagaatatttcacccttcagatccgtgggcgtgagcgcttcgagatg
ttccgagaactgaatgaggccttggaactcaaggatgcccaggctgggaaagagccagcg
gggagcagggctcactccagccacctgaagtccaagaaggggcagtctacctcccgccat
aaaaaactcatgttcaagacagaggggcctgactcagactga

DBGET integrated database retrieval system