KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104671315
Entry
104671315         CDS       T03989                                 

Gene name
MYL3
Definition
(RefSeq) myosin light chain 3
  KO
K12749  myosin light chain 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04260  Cardiac muscle contraction
rro04261  Adrenergic signaling in cardiomyocytes
rro04371  Apelin signaling pathway
rro05410  Hypertrophic cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104671315 (MYL3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104671315 (MYL3)
   04261 Adrenergic signaling in cardiomyocytes
    104671315 (MYL3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104671315 (MYL3)
   05414 Dilated cardiomyopathy
    104671315 (MYL3)
Cytoskeleton proteins [BR:rro04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     104671315 (MYL3)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 Cas9_REC
Other DBs
NCBI-GeneID: 104671315
NCBI-ProteinID: XP_010373071
LinkDB
Position
1
AA seq 197 aa
MAPKKPEPKKDDAKAATKAAPAPAPAPPPEPERPKEVEFDASKIKIEFTPEQIEEFKEAF
MLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEELNTKMMDFETFLPML
QHISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGERLTEDEVEKLMAGQED
SNGCINYEAFVKHIMAS
NT seq 594 nt   +upstreamnt  +downstreamnt
atggcccccaaaaagccagagcccaagaaggatgacgccaaggcggccaccaaggcagct
cccgctcccgctcccgcacctccccctgaacctgagcgccctaaggaggtggagtttgat
gcttccaagatcaagatcgagttcacacctgagcagattgaagagttcaaggaagccttc
atgctgttcgaccgcacacccaagtgtgagatgaagatcacctacgggcagtgtggggat
gtcctgcgggcactgggccagaaccccacacaggcggaggtgctccgtgtcctggggaag
ccaaaacaggaagagctcaataccaagatgatggactttgaaactttcctgcccatgctc
cagcacatttccaaaaacaaggacacgggcacctatgaggacttcgtggaggggctacgg
gtcttcgacaaggagggcaatggcactgtcatgggtgctgagcttcgccacgtgttggcc
acgctgggtgagaggctgacagaagacgaagtagagaagttgatggctgggcaagaggac
tctaacggctgcatcaactacgaagcattcgtgaagcacatcatggccagctaa

DBGET integrated database retrieval system