KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674493
Entry
104674493         CDS       T03989                                 

Gene name
ADORA1
Definition
(RefSeq) adenosine receptor A1 isoform X2
  KO
K04265  adenosine receptor A1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04071  Sphingolipid signaling pathway
rro04080  Neuroactive ligand-receptor interaction
rro04923  Regulation of lipolysis in adipocytes
rro04924  Renin secretion
rro05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    104674493 (ADORA1)
   04024 cAMP signaling pathway
    104674493 (ADORA1)
   04022 cGMP-PKG signaling pathway
    104674493 (ADORA1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104674493 (ADORA1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    104674493 (ADORA1)
   04924 Renin secretion
    104674493 (ADORA1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    104674493 (ADORA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104674493 (ADORA1)
G protein-coupled receptors [BR:rro04030]
 Rhodopsin family
  Base and nucleoside
   Adenosine
    104674493 (ADORA1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 104674493
NCBI-ProteinID: XP_010377119
LinkDB
Position
1
AA seq 359 aa
MSCRAVSTAQPSPTARGPELCCLELWALPLGPLPASRQDAFQAAYIGIEVLIALVSVPGN
VLVIWAVKVNQALRDATFCFIVSLAVADVAVGALVIPLAILINIGPQTYFHTCLMVACPV
LILTQSSILALLAIAVDRYLRVKIPLRYKMVVTPRRAAVAIAGCWILSLVVGLTPMFGWN
NLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFNFFVWVLPPLLLMVLIYLEVFYLI
RKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLFALSWLPLHILNCITLFCPSCHKPS
ILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgagctgccgcgcggtgtccacagcccagcccagccctaccgcgcgcggcccggagctc
tgttgcctggaactttgggcactgcctctgggacccctgcccgccagcaggcaggatgcc
ttccaggccgcctacatcggcatcgaggtgctcatcgccctggtctctgtgcctgggaac
gtgctggtgatctgggcggtgaaggtgaaccaggcgctgcgggatgccaccttctgcttc
atcgtgtcgctggcagtggctgatgtggccgtgggtgccctggtcattcccctcgccatc
ctcatcaacattgggccacagacctacttccatacctgcctcatggttgcctgtccggtc
ctcatcctcacccagagctccatcctggccctgctggcaattgccgtggaccgctacctc
cgggtcaagatccctctccgatacaagatggtggtgaccccccggagggcggcggtggcc
atcgccggctgctggatcctctccttggtggtggggctgacccctatgtttggctggaac
aatctgagcgcagtggagcgggcctgggcagccaatggcagcatgggggagcccgtgatc
aagtgcgagttcgagaaggtcatcagcatggagtacatggtctacttcaacttctttgtg
tgggtgctgcccccgcttctcctcatggtcctcatctacctggaggtcttctacctaatc
cgcaagcagctcaacaagaaggtatcggcctcctctggtgacccacaaaagtactatggg
aaggagctgaagatcgccaagtcgctggccctcatcctcttcctctttgctctcagctgg
ctgcctttgcacatcctcaactgcatcaccctcttctgcccatcctgccacaaacccagc
atcctcacctacattgccatcttcctcacgcacggcaactcggccatgaaccctatcgtc
tacgccttccgcatccagaagttccgcgtcaccttccttaagatttggaatgaccatttc
cgctgccagcccgcaccccccattgatgaggatctcccagaagagaggcctgatgactag

DBGET integrated database retrieval system