KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104675233
Entry
104675233         CDS       T03989                                 

Gene name
IL6
Definition
(RefSeq) interleukin-6 isoform X1
  KO
K05405  interleukin 6
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01523  Antifolate resistance
rro04060  Cytokine-cytokine receptor interaction
rro04061  Viral protein interaction with cytokine and cytokine receptor
rro04066  HIF-1 signaling pathway
rro04068  FoxO signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04218  Cellular senescence
rro04620  Toll-like receptor signaling pathway
rro04621  NOD-like receptor signaling pathway
rro04623  Cytosolic DNA-sensing pathway
rro04625  C-type lectin receptor signaling pathway
rro04630  JAK-STAT signaling pathway
rro04640  Hematopoietic cell lineage
rro04657  IL-17 signaling pathway
rro04659  Th17 cell differentiation
rro04668  TNF signaling pathway
rro04672  Intestinal immune network for IgA production
rro04931  Insulin resistance
rro04932  Non-alcoholic fatty liver disease
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro05010  Alzheimer disease
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05132  Salmonella infection
rro05133  Pertussis
rro05134  Legionellosis
rro05135  Yersinia infection
rro05142  Chagas disease
rro05143  African trypanosomiasis
rro05144  Malaria
rro05146  Amoebiasis
rro05152  Tuberculosis
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
rro05321  Inflammatory bowel disease
rro05323  Rheumatoid arthritis
rro05332  Graft-versus-host disease
rro05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104675233 (IL6)
   04668 TNF signaling pathway
    104675233 (IL6)
   04066 HIF-1 signaling pathway
    104675233 (IL6)
   04068 FoxO signaling pathway
    104675233 (IL6)
   04151 PI3K-Akt signaling pathway
    104675233 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104675233 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    104675233 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    104675233 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104675233 (IL6)
   04620 Toll-like receptor signaling pathway
    104675233 (IL6)
   04621 NOD-like receptor signaling pathway
    104675233 (IL6)
   04623 Cytosolic DNA-sensing pathway
    104675233 (IL6)
   04625 C-type lectin receptor signaling pathway
    104675233 (IL6)
   04659 Th17 cell differentiation
    104675233 (IL6)
   04657 IL-17 signaling pathway
    104675233 (IL6)
   04672 Intestinal immune network for IgA production
    104675233 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104675233 (IL6)
   05202 Transcriptional misregulation in cancer
    104675233 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    104675233 (IL6)
   05321 Inflammatory bowel disease
    104675233 (IL6)
   05332 Graft-versus-host disease
    104675233 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104675233 (IL6)
   05020 Prion disease
    104675233 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    104675233 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104675233 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    104675233 (IL6)
   04931 Insulin resistance
    104675233 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    104675233 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104675233 (IL6)
   05135 Yersinia infection
    104675233 (IL6)
   05133 Pertussis
    104675233 (IL6)
   05134 Legionellosis
    104675233 (IL6)
   05152 Tuberculosis
    104675233 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104675233 (IL6)
   05161 Hepatitis B
    104675233 (IL6)
   05171 Coronavirus disease - COVID-19
    104675233 (IL6)
   05164 Influenza A
    104675233 (IL6)
   05162 Measles
    104675233 (IL6)
   05168 Herpes simplex virus 1 infection
    104675233 (IL6)
   05163 Human cytomegalovirus infection
    104675233 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104675233 (IL6)
   05169 Epstein-Barr virus infection
    104675233 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104675233 (IL6)
   05144 Malaria
    104675233 (IL6)
   05142 Chagas disease
    104675233 (IL6)
   05143 African trypanosomiasis
    104675233 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104675233 (IL6)
   01523 Antifolate resistance
    104675233 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104675233 (IL6)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interleukins
   104675233 (IL6)
SSDB
Motif
Pfam: IL6
Other DBs
NCBI-GeneID: 104675233
NCBI-ProteinID: XP_010378012
LinkDB
Position
6
AA seq 252 aa
MNSVSTSKCRKSLALERPAAVEPCVREGCVAQRGLAGGQQQRQAPSCAVSSRRRSLPSGT
GAFGPVAFSLGLLLVLPAAFPAPVLLGEDSKDVAAPHSQPLTSSERIDKHIRYILDGISA
LRKETCNRSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYL
EYLQNRFESSEEQARAVQMSTKVLIQFLQKKVSVSSFPHLGVGEDRLKDSVLDNSGMQCH
FQKRRLHVNKKV
NT seq 759 nt   +upstreamnt  +downstreamnt
atgaactccgtctccacaagtaagtgcaggaaatccctagccctggaacggccagcggcg
gtcgagccctgtgtgagggagggatgtgtggcccagcgagggctggcgggcggccagcag
cagaggcaggctcccagctgtgctgtcagctcacgccgccgctcgctcccctccggcaca
ggcgccttcggtccagttgccttctccctggggctgctcctggtgttgcctgctgccttc
cctgccccagtactcctaggagaagattccaaagatgtagccgccccacacagccagcca
ctgacctcttcagaacgaattgacaaacacattcggtacatcctcgacggcatctcagcc
ctgagaaaggagacatgtaacaggagtaacatgtgtgaaagcagcaaagaggcactggca
gaaaacaacctgaaccttccaaagatggctgaaaaagatggatgcttccaatctggattc
aatgaggagacttgcctggtgaaaatcatcactggtcttttggagtttgaggtataccta
gagtacctccagaacaggtttgagagcagtgaggaacaagccagagctgtgcagatgagt
acaaaagtcctgatccagttcctgcagaaaaaggtgagtgtgtcctccttccctcacctt
ggtgtgggggaagacaggctcaaagacagtgtcctggacaactcagggatgcaatgccac
ttccaaaagagaaggctacatgtaaacaaaaaagtctga

DBGET integrated database retrieval system