KEGG   Shewanella baltica OS185: Shew185_0179
Entry
Shew185_0179      CDS       T00571                                 

Definition
(GenBank) UDP-N-acetylenolpyruvoylglucosamine reductase
  KO
K00075  UDP-N-acetylmuramate dehydrogenase [EC:1.3.1.98]
Organism
sbm  Shewanella baltica OS185
Pathway
sbm00520  Amino sugar and nucleotide sugar metabolism
sbm00550  Peptidoglycan biosynthesis
sbm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Shew185_0179
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Shew185_0179
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sbm01011]
    Shew185_0179
Enzymes [BR:sbm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.98  UDP-N-acetylmuramate dehydrogenase
     Shew185_0179
Peptidoglycan biosynthesis and degradation proteins [BR:sbm01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Shew185_0179
SSDB
Motif
Pfam: MurB_C FAD_binding_4
Other DBs
NCBI-ProteinID: ABS06350
LinkDB
Position
224047..225072
AA seq 341 aa
MSLAHSLKSFNSFGLAQSCADLVEVHSKEAVQAMCLPLWQQQLPMLVLGGGSNLVFTEDF
NGTVVRILSKGIKVTEDAEAFYLEVEAGENWHELIQFTLEHGMFGLENMALIPGTVGAAP
IQNIGAYGVELCDVCDWVEYLDLPSGEFVRISTAECQFAYRESIFKDKLRNLAVVTAVGL
RLAKRWQPRLAYGPLQSFDPATVTAREIFNRVCQVRSEKLPDPAVLGNAGSFFKNPIVSA
ACYLDLAQRFPTIVGYAQADATVKLAAGWLIEQAGLKGFVLGNAAVHDKQALVLVNRGGA
TGRDICRLALHVIAQVQDKFGVVLEAEPRIMGANGEGDLYV
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgtctctagctcatagccttaaatcgtttaattcctttggtttagcccagtcttgcgcc
gatcttgttgaggtgcactcaaaagaagctgttcaggcgatgtgtttgccactatggcaa
cagcaattgcctatgttggtgcttggtggcggtagcaatctggtcttcacagaggacttt
aacggtacagttgtcaggattttatcgaaggggataaaagtaactgaagacgcagaagca
ttttatctcgaggttgaggcgggtgagaattggcacgagttaattcagtttacgctcgag
catggcatgtttgggctggaaaatatggcgttaattcctggaacggttggcgcagcacct
atccagaatattggcgcttatggtgttgaactctgtgatgtgtgtgattgggttgagtat
cttgatttaccctcaggtgagttcgtgcgtataagcacagctgagtgtcagtttgcttac
cgtgagtctattttcaaagacaaattacgcaatcttgccgtagttacagcagtcggactg
cgcttagctaaacgttggcaaccgcgtttggcctatggtccactgcaatcgtttgatcca
gcaaccgtcactgcgcgtgaaatttttaatcgcgtatgccaagttcgcagtgaaaagctc
ccagatccagcagtgctcggcaatgcaggcagtttctttaaaaatcctattgttagcgcg
gcctgttatctagatttagcacagcgttttccgacgatagtgggttacgcacaagcggat
gcgacggtgaaattggcggcaggttggttgattgaacaagcgggactgaaaggttttgtg
cttggtaatgcggctgtgcatgacaaacaagctttggtattagtgaaccgaggcggggca
acggggcgcgatatttgtcgcttagcgctgcatgttattgcgcaagtacaggataaattt
ggtgttgtgctagaagcagaacctagaatcatgggcgctaacggtgaaggagatttgtat
gtctga

DBGET integrated database retrieval system