KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101038267
Entry
101038267         CDS       T04350                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4 isoform X1
  KO
K05430  interleukin 4
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04640  Hematopoietic cell lineage
sbq04657  IL-17 signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq04659  Th17 cell differentiation
sbq04660  T cell receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04672  Intestinal immune network for IgA production
sbq05140  Leishmaniasis
sbq05200  Pathways in cancer
sbq05310  Asthma
sbq05320  Autoimmune thyroid disease
sbq05321  Inflammatory bowel disease
sbq05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101038267 (IL4)
   04151 PI3K-Akt signaling pathway
    101038267 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101038267 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101038267 (IL4)
   04660 T cell receptor signaling pathway
    101038267 (IL4)
   04658 Th1 and Th2 cell differentiation
    101038267 (IL4)
   04659 Th17 cell differentiation
    101038267 (IL4)
   04657 IL-17 signaling pathway
    101038267 (IL4)
   04664 Fc epsilon RI signaling pathway
    101038267 (IL4)
   04672 Intestinal immune network for IgA production
    101038267 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101038267 (IL4)
  09163 Immune disease
   05310 Asthma
    101038267 (IL4)
   05320 Autoimmune thyroid disease
    101038267 (IL4)
   05321 Inflammatory bowel disease
    101038267 (IL4)
   05330 Allograft rejection
    101038267 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    101038267 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101038267 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:sbq00536]
    101038267 (IL4)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interleukins
   101038267 (IL4)
Glycosaminoglycan binding proteins [BR:sbq00536]
 Heparan sulfate / Haparin
  Cytokines
   101038267 (IL4)
SSDB
Motif
Pfam: IL4 Mannosyl_trans3 Retrotran_gag_2
Other DBs
NCBI-GeneID: 101038267
NCBI-ProteinID: XP_003920654
LinkDB
Position
Unknown
AA seq 151 aa
MGLTSQLLPALFFLLACAGNFVHGHNCDVALEEIIKTLNIVTEQKTLCTELTVMDIFAAS
KNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQHFHSHKQLIRSLKRLDRNLCSLAGL
NSCPVKEANQTMLKDFLERLKMIMKEKYSKC
NT seq 456 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccaactgcttcccgctctgttctttctgttagcatgcgccggcaac
tttgtccatggacacaactgcgatgttgccttagaggagatcatcaaaactttgaacatt
gtcacagagcaaaagactctgtgcaccgagttgaccgtaatggacatctttgctgcctcc
aagaacacaactgagaaggaaaccttctgcagggctgcgactgtgctccggcagttctac
agccaccatgagaaggacactcgctgcctgggtgcaactgcacagcatttccacagtcac
aagcagctgatccgatccctgaaacggctggacaggaacctctgcagcctggcgggcttg
aactcctgtcctgtgaaggaagccaaccagactatgttgaaagacttcttggaaaggcta
aagatgatcatgaaagagaaatattcaaagtgttga

DBGET integrated database retrieval system