KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101039608
Entry
101039608         CDS       T04350                                 

Gene name
HMOX1
Definition
(RefSeq) heme oxygenase 1
  KO
K00510  heme oxygenase 1 [EC:1.14.14.18]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00860  Porphyrin and chlorophyll metabolism
sbq01100  Metabolic pathways
sbq04066  HIF-1 signaling pathway
sbq04216  Ferroptosis
sbq04978  Mineral absorption
sbq05200  Pathways in cancer
sbq05206  MicroRNAs in cancer
sbq05225  Hepatocellular carcinoma
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    101039608 (HMOX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    101039608 (HMOX1)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    101039608 (HMOX1)
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    101039608 (HMOX1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101039608 (HMOX1)
   05206 MicroRNAs in cancer
    101039608 (HMOX1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101039608 (HMOX1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101039608 (HMOX1)
Enzymes [BR:sbq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.18  heme oxygenase (biliverdin-producing)
     101039608 (HMOX1)
SSDB
Motif
Pfam: Heme_oxygenase
Other DBs
NCBI-GeneID: 101039608
NCBI-ProteinID: XP_003932972
UniProt: A0A2K6RY67
LinkDB
Position
Unknown
AA seq 288 aa
MERTQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTREGFKLVMASLHHIYVA
LEEEIERNKENPAFAPLYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHE
VGRAEPELLVAHAYTRYLGDLSGGQVLKKIAQKVLGLPSSGEGLAFFTFPNIDSATKFKQ
LYRSRMNSLEMTPEVRQRVMEEAKMAFLLNIQLFEELQKLLTHDTKDQSPSQAPGLRQRA
SNKVQDSTLVETPRGKPLLNTSSQAPLLRWVLTLSFLVATVAVGLYAM
NT seq 867 nt   +upstreamnt  +downstreamnt
atggagcgcacgcaacccgacagcatgccccaggatttgtcagaggccctgaaggaggcc
accaaggaggtgcacacccaggcagagaatgctgagttcatgaggaactttcagaagggc
caggtgaccagagagggcttcaagctggtgatggcctccctgcaccacatctacgtggcc
ctggaggaggagattgagcgcaacaaggagaacccagcgttcgcccctctctacttccca
gaagagctgcaccgcaaggccgctctggagcaggacctggccttctggtatgggccccgc
tggcaggaggtgatcccctacacaccagccatgcagcgctatgtgaagcggctccatgag
gtggggcgtgcagagcctgagctactggtggcccacgcctatacccgctacctgggtgac
ctgtctgggggccaggtgctcaagaagattgctcagaaagtcctgggcctgcccagctct
ggcgagggcctggccttcttcaccttccccaatatcgacagtgccaccaagttcaagcag
ctctaccgctcccgcatgaactctctggagatgactcccgaggtcaggcagcgggtgatg
gaagaggccaagatggcgttcctgctcaacatccagctctttgaggagttgcagaagctg
ctgacccatgacaccaaggatcagagcccctcacaggcaccagggcttcgccagagggcc
agtaacaaagtgcaagactctaccctggtggagactcccagagggaagccccttctcaac
accagctcccaggctccgcttctccgttgggtccttacactcagctttctggtggcgaca
gttgctgtagggctttatgccatgtga

DBGET integrated database retrieval system