KEGG   Saccharopolyspora erythraea: SACE_0713
Entry
SACE_0713         CDS       T00492                                 

Gene name
eryK
Definition
(GenBank) cytochrome P450 Erythromycin B/D C-12 hydroxylase
  KO
K14370  erythromycin 12 hydroxylase [EC:1.14.13.154]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00522  Biosynthesis of 12-, 14- and 16-membered macrolides
sen01052  Type I polyketide structures
sen01100  Metabolic pathways
sen01110  Biosynthesis of secondary metabolites
Module
sen_M00774  Erythromycin biosynthesis, propanoyl-CoA + methylmalonyl-CoA => deoxyerythronolide B => erythromycin A/B
Brite
KEGG Orthology (KO) [BR:sen00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01052 Type I polyketide structures
    SACE_0713 (eryK)
   00522 Biosynthesis of 12-, 14- and 16-membered macrolides
    SACE_0713 (eryK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:sen01008]
    SACE_0713 (eryK)
   00199 Cytochrome P450 [BR:sen00199]
    SACE_0713 (eryK)
Enzymes [BR:sen01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.154  erythromycin 12-hydroxylase
     SACE_0713 (eryK)
Polyketide biosynthesis proteins [BR:sen01008]
 Polyketide tailoring proteins
  Oxygenase
   SACE_0713 (eryK)
Cytochrome P450 [BR:sen00199]
 Cytochrome P450, bacteria type
  CYP113 family
   SACE_0713 (eryK)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: CAM00054
Cambridge: SACE_0713
Kitasato: SACE_0713
UniProt: P48635
LinkDB
Structure
PDB: 

Position
778654..779847
AA seq 397 aa
MTTIDEVPGMADETALLDWLGTMREKQPVWQDRYGVWHVFRHADVQTVLRDTATFSSDPT
RVIEGASPTPGMIHEIDPPEHRALRKVVSSAFTPRTISDLEPRIRDVTRSLLADAGESFD
LVDVLAFPLPVTIVAELLGLPPMDHEQFGDWSGALVDIQMDDPTDPALAERIADVLNPLT
AYLKARCAERRADPGDDLISRLVLAEVDGRALDDEEAANFSTALLLAGHITTTVLLGNIV
RTLDEHPAHWDAAAEDPGRIPAIVEEVLRYRPPFPQMQRTTTKATEVAGVPIPADVMVNT
WVLSANRDSDAHDDPDRFDPSRKSGGAAQLSFGHGVHFCLGAPLARLENRVALEEIIARF
GRLTVDRDDERLRHFEQIVLGTRHLPVLAGSSPRQSA
NT seq 1194 nt   +upstreamnt  +downstreamnt
ttgaccaccatcgacgaagttcccggcatggccgacgaaaccgcactcctcgactggctg
ggcacgatgcgcgagaagcagccggtgtggcaggaccggtacggcgtgtggcacgtcttc
cgccacgccgacgtccagacggtgttgcgcgacaccgccacgttctcctccgacccgacc
cgcgtcatcgagggcgcgagcccgacgccgggcatgatccacgagatcgacccgccggag
caccgcgccctgcgcaaggtcgtcagcagcgccttcaccccgcgcaccatctccgacctc
gaaccccgcatccgcgacgtcacccgctcgctgctggccgatgccggcgagagcttcgac
ctcgtcgacgtgctcgcgttcccgctgccggtcacgatcgtcgcggagctgctgggcctg
ccgccgatggaccacgagcagttcggcgactggtcgggtgccctggtcgacatccagatg
gacgacccgaccgacccggcgctggccgaacggatcgcggatgtgctcaacccgctcacc
gcgtacctgaaggcccgctgcgccgagcgccgcgccgatcccggcgacgacctgatctcc
cgccttgtcctggccgaggtcgacgggcgcgcgctcgacgacgaggaggcggccaacttc
tccaccgcgctgctgctggccggccacatcaccacgaccgtcctgctcggcaacatcgtg
cgcaccctcgacgagcacccggcccactgggacgccgccgccgaggaccccggccggatc
ccggcgatcgtcgaggaggtcctgcgctaccggccgccgttcccgcagatgcagcgcacg
acgaccaaggccaccgaggtcgcgggcgtgcccatcccggccgacgtcatggtcaacacc
tgggtgctctcggccaaccgcgactccgacgcccacgacgaccccgaccggttcgacccg
tcgcgcaagtccggcggcgccgcgcagctctccttcggccacggcgtgcacttctgcctc
ggcgcgcccctggcccggctggagaaccgcgtggcgctggaggagatcatcgcccggttc
gggcggctcaccgtcgaccgcgacgacgagcgcctgcgccacttcgaacagatcgtgctc
gggacccgtcacctgccggtgctggcgggctcctcgccgaggcagtcggcgtag

DBGET integrated database retrieval system