KEGG   Scleropages formosus (Asian bonytongue): 108926133Help
Entry
108926133         CDS       T04919                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00052  Galactose metabolism
sfm00500  Starch and sucrose metabolism
sfm01100  Metabolic pathways
sfm04142  Lysosome
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    108926133
   00500 Starch and sucrose metabolism
    108926133
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    108926133
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sfm04147]
    108926133
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     108926133
Exosome [BR:sfm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108926133
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 108926133
NCBI-ProteinID: XP_018594173
UniProt: A0A1W4Z0G8
LinkDB All DBs
Position
Unknown
AA seq 962 aa AA seqDB search
MVSYKLLTPEDVYFSGGSGSVEEPLEEPVEEKPANSPLLEKKTVCSASTSFIALGAFLLV
VCVVWVIGTVFWLRSPSGQFPHRPPSPASGSASASTVVSAPSREGLACSGVPENWRFDCY
PEKVVVTRELCEARNCCFIQVSSGKKPIKDGVPWCFYPPNFPTYWLDALNDTDLGFTAQL
KKSEKTYYPKDVETIQLDVLYETDSRLRVKITDPSYPRFEVPISVPNATQKASSPLYTVE
FSKKPFGLIVKRTSTGTVIINTTVAPVFYADQFLQLSTSLPTRYVYGLGEHRSTFLHDIE
WNTLTMWARDVAPMEKTNLYGVHPFYLGMEQGGSAHGVFLLNSNAMDVVLQPAPAITWRT
IGGILDIYIFLGPDPSSVIQQYLQVVGSPAMPPYWALGYHLCRWGYNSSDNTWEMVRTMR
KYGIPQDVQWNDIDYMDRSMDFTMDPQNFATLPEMVKDLHSHGQKYVMILDPGISSTQQP
GTYWPYDDGLKRGIFINDSSGQTLIGKVWPGLTAFPDFSSQETHRWWYDNLQRFHDKVQF
DGLWIDMNEPSNFLDGSLKGCPSNDLENPPYTPGVLGGSLRAKTLCASALQKTSVHYNMH
SLYGLLEAKASSSALKMILGKRPFVISRSTFPSQGLYSGHWLGDNRSQWTDLYTSISGML
TFNILGIPLIGADICGFGGTTTEEMCVRWTQLGAFYPFTRNHNSINEKAQDPSAFSPSAR
TAMQEALLLRYSLFPLLYTLFHHAHLEGHTVARPLLFEFPNDEKTYSIDRQFLWGRSLLV
TPVLDPGVSYVVGYFPKALWYDFFTGNSLRSQGETVKLQAPLDKINVHLREGAVIPTQRP
NTTLWVSSGQPLHLICSLTDEGTAAGDLFWDDGETIDTYETDQYAYIVFHVAKNVMTSQV
LHDNVEATFITVETVSFYGVKEEPSNVTVNSQDVPFTYKGNQVLTVTDLGLNLSQNFTIS
WA
NT seq 2889 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcctacaaactgctgaccccggaggacgtgtacttctccgggggctccggctcc
gttgaggaaccgctggaggagcccgtggaggagaagcccgcgaacagtcccctgctggag
aagaagaccgtatgttccgcctccaccagcttcatcgccctgggcgctttcctgctggtg
gtgtgtgtcgtctgggtgatcggcaccgttttttggctgcgcagtccaagcggccagttt
ccgcatagacctccatcccctgcgtcggggtccgcctctgcctcgaccgtggtctcggcc
ccgtcccgcgaagggctcgcctgcagcggagtccccgagaactggcgcttcgactgctac
ccggagaaggtggtggtgacgcgggagctctgtgaggccaggaactgctgtttcatccag
gtgtcttcaggcaagaagccgatcaaggatggggtgccttggtgcttctacccccctaac
ttccctacgtactggctagacgcgctgaacgacactgaccttggattcacggcacagctg
aagaagtcagagaaaacatactatcccaaggacgttgaaacgatccagctggatgttttg
tatgaaaccgactcaaggctgcgtgtaaaaattacagacccttcctacccgaggttcgaa
gtccccatctctgtacccaacgccacgcagaaagcatccagtcctctttacactgtggag
ttctccaagaagccttttggcttgatagtgaaaagaacatctactggaacggtcataatt
aataccacagtggctccggtgttctacgcagaccagttcctccagttgtccacttccctc
cccacgcggtatgtgtatgggttgggggaacatcgctcaaccttccttcatgacatcgag
tggaacacccttaccatgtgggcccgagatgtagcgcctatggaaaaaactaatctgtat
ggtgttcacccgttctacttgggaatggaacaaggtggttcagctcatggggtttttctt
ttgaacagcaacgccatggatgttgtccttcaaccagccccagcgattacttggcgtacc
attggtggaatattggacatttacattttcctgggacctgatcccagctcagttatacag
cagtacctgcaggttgttggttctcctgccatgccaccgtattgggctttaggatatcac
ctgtgtcgctggggatataattcaagtgataatacctgggaaatggtgaggaccatgaga
aaatatggcataccccaggatgtacaatggaacgatattgactacatggaccggtccatg
gatttcaccatggacccccagaactttgctacacttccagaaatggtgaaggatctacat
agtcatggacagaaatacgtcatgattctggaccctgggatcagtagtactcagcagcca
ggcacttactggccttatgatgatggcttgaagaggggcatctttattaatgattccagc
gggcaaacgttgattggaaaggtttggccaggtttgacagccttccctgacttctccagc
caggaaacacacagatggtggtatgataacctgcagaggttccatgacaaagtccagttt
gatggattgtggattgatatgaacgaaccttcaaacttcttggatggatcgttgaagggc
tgtccgtccaatgacctagaaaatcccccatatacacctggggttcttggtggctcactg
agagccaagacactgtgtgcttctgccctccagaaaacatctgttcactataacatgcac
agcttgtatggcctgctggaggccaaagcctcctcctccgccttgaagatgattttggga
aagcgcccatttgtcatatcacgctcaactttccccagtcaaggactttactctgggcac
tggctcggggacaaccggagtcagtggacggatttgtacacctctataagtggcatgctg
accttcaacatcttgggcattccgctcattggagctgacatctgcggctttggcggcact
accacagaggagatgtgtgtgcggtggacccagctaggggccttctaccccttcactcgc
aaccacaactccatcaatgagaaggcccaggacccgagcgctttcagcccctcagcccgc
acggccatgcaggaggcgctgctgctgcgctactcgcttttccccctcctctacacactc
ttccatcatgcccacctggaggggcacactgtggcccggcccctgctatttgagtttcca
aatgatgagaaaacatactccatagatcggcagtttctctgggggcggagcttactggtg
acccctgtgttagatccaggtgtcagctatgtcgttggatacttccccaaagccctgtgg
tatgacttttttacggggaactctttgaggagccagggagagacagtgaagctccaggca
ccactggacaagattaatgtccatctccgtgagggagcagttatccccacacagaggccc
aatactaccttgtgggtgagcagtgggcaaccgctgcacctcatctgcagcctgacggat
gagggcacagcagcaggagacctcttttgggacgatggggagaccattgacacctatgaa
acagaccaatatgcctacattgtgttccatgtggcaaagaatgtgatgacctcacaagtc
cttcacgacaacgtagaggccacgttcatcaccgtggagactgtgtccttttatggagtg
aaagaagaaccatcaaatgtgactgtgaactcccaagacgttccttttacatacaaaggc
aatcaggttttaactgtgacagatcttggtctgaacctcagtcagaactttactatcagc
tgggcatag

DBGET integrated database retrieval system