KEGG   Sinocyclocheilus grahami: 107570916
Entry
107570916         CDS       T04918                                 

Definition
(RefSeq) interleukin-6-like
  KO
K05405  interleukin 6
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04060  Cytokine-cytokine receptor interaction
sgh04068  FoxO signaling pathway
sgh04218  Cellular senescence
sgh04620  Toll-like receptor signaling pathway
sgh04621  NOD-like receptor signaling pathway
sgh04623  Cytosolic DNA-sensing pathway
sgh04625  C-type lectin receptor signaling pathway
sgh04672  Intestinal immune network for IgA production
sgh05132  Salmonella infection
sgh05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107570916
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107570916
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107570916
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107570916
   04621 NOD-like receptor signaling pathway
    107570916
   04623 Cytosolic DNA-sensing pathway
    107570916
   04625 C-type lectin receptor signaling pathway
    107570916
   04672 Intestinal immune network for IgA production
    107570916
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107570916
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107570916
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sgh04052]
    107570916
Cytokines and growth factors [BR:sgh04052]
 Cytokines
  Interleukins
   107570916
SSDB
Motif
Pfam: IL6 DUF4807 WIYLD
Other DBs
NCBI-GeneID: 107570916
NCBI-ProteinID: XP_016112675
LinkDB
Position
Unknown
AA seq 259 aa
MPSAQNAALFLSAVLAAFISLGDAVPAYSDAALFLSAVLAAFISLGDAVPAYSGLAELSE
TSGDEAQDVEGKSPLSEWQKWYLMARDLHRDVKTLRDQQFERDFRETENMTAYEGVRIET
PLLEPSDGCLSRNFSAERCLSRIYSVLTWYKENWSFMEKENLTWSLVKDIKHGSKRLLEA
LNSQLQIADGQTDQISSAPLSVRSAWTRKTTTHSILFNFSSVMIDTCRALNYISKHKAAH
RAKDTKRPADWSSDKNSFT
NT seq 780 nt   +upstreamnt  +downstreamnt
atgccgtcagctcagaacgcagcactcttcctgtctgctgtactggcagcgttcatcagt
ctgggggatgccgtgcctgcctacagcgacgcagcactcttcctgtctgctgtactggca
gcgttcatcagtctgggggatgccgtgcctgcctacagcggtctggccgaactctccgaa
acatctggagacgaggctcaggacgtggagggaaagagtcctctgagcgagtggcagaaa
tggtatctgatggccagagatctgcacagagacgtcaagacgctgcgagaccagcagttt
gagagggacttcagagagacggagaacatgacggcgtatgagggagtgaggatcgaaacg
cctctcctcgaaccctccgacggctgtctgtccagaaacttcagcgcagaaaggtgtctg
agccgcatttacagcgtcttgacctggtacaaagagaactggagcttcatggagaaggaa
aacctgacctggagcctggtgaaggacatcaaacacgggagcaagcggctgctggaggcc
ctcaacagccagctgcagatagcggacggacagacggatcagatctccagcgctcctcta
tcggtcagatccgcatggacgcgcaagaccacgacgcattcgatcctgttcaacttcagc
agcgtgatgatcgacacgtgcagagccctcaattacatcagcaaacacaaagctgcacac
cgagcaaaagacacgaagagacccgcagactggagctccgacaagaactcgtttacctga

KEGG   Sinocyclocheilus grahami: 107571360
Entry
107571360         CDS       T04918                                 

Definition
(RefSeq) interleukin-6-like
  KO
K05405  interleukin 6
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04060  Cytokine-cytokine receptor interaction
sgh04068  FoxO signaling pathway
sgh04218  Cellular senescence
sgh04620  Toll-like receptor signaling pathway
sgh04621  NOD-like receptor signaling pathway
sgh04623  Cytosolic DNA-sensing pathway
sgh04625  C-type lectin receptor signaling pathway
sgh04672  Intestinal immune network for IgA production
sgh05132  Salmonella infection
sgh05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107571360
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107571360
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107571360
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107571360
   04621 NOD-like receptor signaling pathway
    107571360
   04623 Cytosolic DNA-sensing pathway
    107571360
   04625 C-type lectin receptor signaling pathway
    107571360
   04672 Intestinal immune network for IgA production
    107571360
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107571360
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107571360
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sgh04052]
    107571360
Cytokines and growth factors [BR:sgh04052]
 Cytokines
  Interleukins
   107571360
SSDB
Motif
Pfam: IL6 IL12 WIYLD
Other DBs
NCBI-GeneID: 107571360
NCBI-ProteinID: XP_016113166
LinkDB
Position
Unknown
AA seq 232 aa
MPSAQNAALFLSAVLAAFLSLVDAVPAYSGLAELSETSGDEVQDVEGKSPLSERQKWHLM
ARDLHRDVKMLRDQQFERDFRETVNMTAYEGVRITTPLLRPSDGCLSRNFSADLCLSRIY
SVLSWYKENWSLIENENLTSSLVKDIKRGTKRLLEAINSQLQIADGGVDQISSAPLSVRS
AWTRKTTTHSILFNFTSMMIDTCRAVHYMSKRKTAHRAKDMKRPADWSSDKN
NT seq 699 nt   +upstreamnt  +downstreamnt
atgccgtcagctcagaacgcagcgctcttcctgtctgctgtactggcagcgttcctcagt
ctggtggatgcggtgcctgcctacagcggtctggccgaactctccgaaacatctggagac
gaggttcaggacgtggagggaaagagtcctctgagcgagcggcagaaatggcatctgatg
gccagagatctgcacagagacgtcaagatgctgcgagaccagcagtttgagagggacttc
agagagacggtgaacatgacggcgtatgaaggcgtgaggatcacaactcctctcctcaga
ccctctgacggctgtctgtccagaaacttcagcgcagatttgtgtctgagccgcatttac
agcgtcctgagctggtataaagagaactggagcttgatcgagaacgaaaacctgacctcc
agcctggtgaaggacatcaaacgcgggaccaagcgcctgctggaggccattaacagccag
ctgcagatagcagacggaggggtggatcagatctccagcgctcctctatcggtcagatcc
gcgtggacgcgcaagactacgacgcattcgatcctgttcaacttcaccagcatgatgatc
gacacgtgcagagccgtccattacatgagcaaacgcaaaactgcacaccgagcaaaagac
atgaagagacccgcagactggagctccgacaagaactag

DBGET integrated database retrieval system