KEGG   Sarcophilus harrisii (Tasmanian devil): 100913337
Entry
100913337         CDS       T02286                                 

Gene name
PRKCA
Definition
(RefSeq) protein kinase C alpha type
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr04010  MAPK signaling pathway
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04015  Rap1 signaling pathway
shr04020  Calcium signaling pathway
shr04066  HIF-1 signaling pathway
shr04070  Phosphatidylinositol signaling system
shr04071  Sphingolipid signaling pathway
shr04072  Phospholipase D signaling pathway
shr04150  mTOR signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04261  Adrenergic signaling in cardiomyocytes
shr04270  Vascular smooth muscle contraction
shr04310  Wnt signaling pathway
shr04360  Axon guidance
shr04370  VEGF signaling pathway
shr04510  Focal adhesion
shr04540  Gap junction
shr04613  Neutrophil extracellular trap formation
shr04650  Natural killer cell mediated cytotoxicity
shr04664  Fc epsilon RI signaling pathway
shr04666  Fc gamma R-mediated phagocytosis
shr04670  Leukocyte transendothelial migration
shr04713  Circadian entrainment
shr04720  Long-term potentiation
shr04723  Retrograde endocannabinoid signaling
shr04724  Glutamatergic synapse
shr04725  Cholinergic synapse
shr04726  Serotonergic synapse
shr04727  GABAergic synapse
shr04728  Dopaminergic synapse
shr04730  Long-term depression
shr04750  Inflammatory mediator regulation of TRP channels
shr04911  Insulin secretion
shr04912  GnRH signaling pathway
shr04916  Melanogenesis
shr04918  Thyroid hormone synthesis
shr04919  Thyroid hormone signaling pathway
shr04921  Oxytocin signaling pathway
shr04925  Aldosterone synthesis and secretion
shr04926  Relaxin signaling pathway
shr04928  Parathyroid hormone synthesis, secretion and action
shr04929  GnRH secretion
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr04935  Growth hormone synthesis, secretion and action
shr04960  Aldosterone-regulated sodium reabsorption
shr04961  Endocrine and other factor-regulated calcium reabsorption
shr04970  Salivary secretion
shr04971  Gastric acid secretion
shr04972  Pancreatic secretion
shr05017  Spinocerebellar ataxia
shr05022  Pathways of neurodegeneration - multiple diseases
shr05031  Amphetamine addiction
shr05032  Morphine addiction
shr05143  African trypanosomiasis
shr05146  Amoebiasis
shr05161  Hepatitis B
shr05163  Human cytomegalovirus infection
shr05164  Influenza A
shr05170  Human immunodeficiency virus 1 infection
shr05171  Coronavirus disease - COVID-19
shr05200  Pathways in cancer
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05214  Glioma
shr05223  Non-small cell lung cancer
shr05225  Hepatocellular carcinoma
shr05231  Choline metabolism in cancer
shr05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100913337 (PRKCA)
   04012 ErbB signaling pathway
    100913337 (PRKCA)
   04014 Ras signaling pathway
    100913337 (PRKCA)
   04015 Rap1 signaling pathway
    100913337 (PRKCA)
   04310 Wnt signaling pathway
    100913337 (PRKCA)
   04370 VEGF signaling pathway
    100913337 (PRKCA)
   04066 HIF-1 signaling pathway
    100913337 (PRKCA)
   04020 Calcium signaling pathway
    100913337 (PRKCA)
   04070 Phosphatidylinositol signaling system
    100913337 (PRKCA)
   04072 Phospholipase D signaling pathway
    100913337 (PRKCA)
   04071 Sphingolipid signaling pathway
    100913337 (PRKCA)
   04151 PI3K-Akt signaling pathway
    100913337 (PRKCA)
   04150 mTOR signaling pathway
    100913337 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100913337 (PRKCA)
   04540 Gap junction
    100913337 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100913337 (PRKCA)
   04650 Natural killer cell mediated cytotoxicity
    100913337 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    100913337 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    100913337 (PRKCA)
   04670 Leukocyte transendothelial migration
    100913337 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    100913337 (PRKCA)
   04929 GnRH secretion
    100913337 (PRKCA)
   04912 GnRH signaling pathway
    100913337 (PRKCA)
   04921 Oxytocin signaling pathway
    100913337 (PRKCA)
   04926 Relaxin signaling pathway
    100913337 (PRKCA)
   04935 Growth hormone synthesis, secretion and action
    100913337 (PRKCA)
   04918 Thyroid hormone synthesis
    100913337 (PRKCA)
   04919 Thyroid hormone signaling pathway
    100913337 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    100913337 (PRKCA)
   04916 Melanogenesis
    100913337 (PRKCA)
   04925 Aldosterone synthesis and secretion
    100913337 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100913337 (PRKCA)
   04270 Vascular smooth muscle contraction
    100913337 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    100913337 (PRKCA)
   04971 Gastric acid secretion
    100913337 (PRKCA)
   04972 Pancreatic secretion
    100913337 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100913337 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100913337 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    100913337 (PRKCA)
   04727 GABAergic synapse
    100913337 (PRKCA)
   04725 Cholinergic synapse
    100913337 (PRKCA)
   04728 Dopaminergic synapse
    100913337 (PRKCA)
   04726 Serotonergic synapse
    100913337 (PRKCA)
   04720 Long-term potentiation
    100913337 (PRKCA)
   04730 Long-term depression
    100913337 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    100913337 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100913337 (PRKCA)
  09158 Development and regeneration
   04360 Axon guidance
    100913337 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100913337 (PRKCA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100913337 (PRKCA)
   05206 MicroRNAs in cancer
    100913337 (PRKCA)
   05205 Proteoglycans in cancer
    100913337 (PRKCA)
   05231 Choline metabolism in cancer
    100913337 (PRKCA)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100913337 (PRKCA)
   05214 Glioma
    100913337 (PRKCA)
   05223 Non-small cell lung cancer
    100913337 (PRKCA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100913337 (PRKCA)
   05161 Hepatitis B
    100913337 (PRKCA)
   05171 Coronavirus disease - COVID-19
    100913337 (PRKCA)
   05164 Influenza A
    100913337 (PRKCA)
   05163 Human cytomegalovirus infection
    100913337 (PRKCA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100913337 (PRKCA)
   05143 African trypanosomiasis
    100913337 (PRKCA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100913337 (PRKCA)
   05022 Pathways of neurodegeneration - multiple diseases
    100913337 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    100913337 (PRKCA)
   05032 Morphine addiction
    100913337 (PRKCA)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100913337 (PRKCA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100913337 (PRKCA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100913337 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100913337 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:shr04131]
    100913337 (PRKCA)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100913337 (PRKCA)
Protein kinases [BR:shr01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100913337 (PRKCA)
Membrane trafficking [BR:shr04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    100913337 (PRKCA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2
Other DBs
NCBI-GeneID: 100913337
NCBI-ProteinID: XP_031821528
Ensembl: ENSSHAG00000009585
LinkDB
Position
4
AA seq 674 aa
MADVFPANDSTTSQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLLHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTAEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPTDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNME
LRQKFEKAKLGPAGNKVISPSDDRKSNVPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADR
KGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVME
YVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKQGIIYRDLKLDNVMLDSEGHIK
IADFGMCKEHMLDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPF
DGEDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGSEGERDIREHAFFR
RIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQADFEGFSY
VNPQFVHPILQSAV
NT seq 2025 nt   +upstreamnt  +downstreamnt
atggccgacgttttcccggccaatgactctaccacgtctcaggacgtggccaaccgtttt
gcccgcaaaggggcgctaaggcagaagaacgtgcatgaagtcaaggaccacaaattcatc
gcccgcttcttcaagcagcccaccttctgcagccattgcactgacttcatctgggggttt
gggaaacaaggtttccagtgccaagtttgctgttttgttgttcacaagaggtgccatgaa
tttgtcactttctcttgtccgggtgcagataaagggcctgacactgatgaccccagaagt
aagcacaagtttaaaatccacacatatggaagccctactttttgtgatcactgtggctca
ctgctttatggacttctacatcaaggaatgaaatgtgacacctgtgatatgaatgttcac
aaacaatgtgtaataaatgttccaagcctctgtggaatggaccatacagaaaaaagagga
cgaatttatctgaaagcagaagtcacagctgaaaaactacatgtcacagtacgagatgca
aaaaacttaatccctatggatccaaatggactttcagatccctatgtgaagctgaaactt
atccctgaccctaagaatgaaagtaaacaaaaaaccaaaacaatccgctccacactaaac
ccacagtggaatgagtcattcacattcaaattaaaacctacagataaagatagacggtta
tctgttgagatctgggactgggatcgaacaacaagaaatgattttatgggttcactttca
tttggggtatccgagcttatgaaaatgccggcaagtggatggtataagttgcttaatcaa
gaagaaggtgaatactacaatgtgcccattccagaaggggatgaagaaggaaatatggaa
ctgagacagaagtttgaaaaagccaagcttggccctgctggtaacaaggtgatcagtcca
tcagatgacagaaaatccaatgtaccatccaacaaccttgacagagtgaaacttacagac
tttaattttctcatggtcctggggaagggtagttttggaaaggtgatgttggctgaccgg
aagggaacagaagaactatatgccatcaaaattttgaaaaaagatgtggtgatacaagat
gatgatgttgaatgcacaatggtagagaagagagtattagcactcctagacaagcctcct
ttcttaacacaactacactcctgtttccagacagtggatcgtctttattttgtcatggaa
tatgtcaatggtggagatctcatgtaccacattcagcaagtaggaaaatttaaggagcca
caggcagtgttctatgcagcagagatttcaattggattattcttccttcataaacaaggg
atcatttatagagatttgaaattagacaatgtcatgttggattcagaaggacacatcaag
attgctgattttggaatgtgtaaagagcatatgttagatggagtcacaaccaggaccttc
tgtggaactccagattacattgctccagagatcattgcttatcagccgtatggaaaatct
gtggactggtgggcctatggtgtcctcttatatgaaatgttagctggacagcctccattt
gatggtgaagatgaggatgaactcttccagtccataatggaacacaatgtttcctatcca
aaatcattgtccaaggaggctgtttccatctgcaaaggactaatgacaaagcaccctgca
aaacgcctgggctgtggatctgagggagaaagggacatcagagaacatgcatttttcaga
agaattgactgggagaaattggagaacagagagatccaaccaccatttaaacctaaagtg
tgtggcaaaggagcagaaaactttgacaaattctttacccgaggacagccagtgttaaca
ccacctgatcaactggtcattgctaacatagaccaagccgattttgaagggttctcttat
gtcaacccacagtttgtgcaccccatcttgcagagtgcggtatga

KEGG   Sarcophilus harrisii (Tasmanian devil): 100924022
Entry
100924022         CDS       T02286                                 

Gene name
PRKCB
Definition
(RefSeq) protein kinase C beta type isoform X1
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr04010  MAPK signaling pathway
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04015  Rap1 signaling pathway
shr04020  Calcium signaling pathway
shr04062  Chemokine signaling pathway
shr04064  NF-kappa B signaling pathway
shr04066  HIF-1 signaling pathway
shr04070  Phosphatidylinositol signaling system
shr04071  Sphingolipid signaling pathway
shr04150  mTOR signaling pathway
shr04270  Vascular smooth muscle contraction
shr04310  Wnt signaling pathway
shr04370  VEGF signaling pathway
shr04510  Focal adhesion
shr04540  Gap junction
shr04613  Neutrophil extracellular trap formation
shr04650  Natural killer cell mediated cytotoxicity
shr04662  B cell receptor signaling pathway
shr04666  Fc gamma R-mediated phagocytosis
shr04670  Leukocyte transendothelial migration
shr04713  Circadian entrainment
shr04720  Long-term potentiation
shr04723  Retrograde endocannabinoid signaling
shr04724  Glutamatergic synapse
shr04725  Cholinergic synapse
shr04726  Serotonergic synapse
shr04727  GABAergic synapse
shr04728  Dopaminergic synapse
shr04730  Long-term depression
shr04750  Inflammatory mediator regulation of TRP channels
shr04911  Insulin secretion
shr04912  GnRH signaling pathway
shr04916  Melanogenesis
shr04918  Thyroid hormone synthesis
shr04919  Thyroid hormone signaling pathway
shr04921  Oxytocin signaling pathway
shr04925  Aldosterone synthesis and secretion
shr04928  Parathyroid hormone synthesis, secretion and action
shr04929  GnRH secretion
shr04931  Insulin resistance
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr04935  Growth hormone synthesis, secretion and action
shr04960  Aldosterone-regulated sodium reabsorption
shr04961  Endocrine and other factor-regulated calcium reabsorption
shr04970  Salivary secretion
shr04971  Gastric acid secretion
shr04972  Pancreatic secretion
shr04973  Carbohydrate digestion and absorption
shr05017  Spinocerebellar ataxia
shr05022  Pathways of neurodegeneration - multiple diseases
shr05031  Amphetamine addiction
shr05032  Morphine addiction
shr05140  Leishmaniasis
shr05143  African trypanosomiasis
shr05146  Amoebiasis
shr05161  Hepatitis B
shr05163  Human cytomegalovirus infection
shr05164  Influenza A
shr05170  Human immunodeficiency virus 1 infection
shr05171  Coronavirus disease - COVID-19
shr05200  Pathways in cancer
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05214  Glioma
shr05223  Non-small cell lung cancer
shr05225  Hepatocellular carcinoma
shr05231  Choline metabolism in cancer
shr05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100924022 (PRKCB)
   04012 ErbB signaling pathway
    100924022 (PRKCB)
   04014 Ras signaling pathway
    100924022 (PRKCB)
   04015 Rap1 signaling pathway
    100924022 (PRKCB)
   04310 Wnt signaling pathway
    100924022 (PRKCB)
   04370 VEGF signaling pathway
    100924022 (PRKCB)
   04064 NF-kappa B signaling pathway
    100924022 (PRKCB)
   04066 HIF-1 signaling pathway
    100924022 (PRKCB)
   04020 Calcium signaling pathway
    100924022 (PRKCB)
   04070 Phosphatidylinositol signaling system
    100924022 (PRKCB)
   04071 Sphingolipid signaling pathway
    100924022 (PRKCB)
   04150 mTOR signaling pathway
    100924022 (PRKCB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100924022 (PRKCB)
   04540 Gap junction
    100924022 (PRKCB)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100924022 (PRKCB)
   04650 Natural killer cell mediated cytotoxicity
    100924022 (PRKCB)
   04662 B cell receptor signaling pathway
    100924022 (PRKCB)
   04666 Fc gamma R-mediated phagocytosis
    100924022 (PRKCB)
   04670 Leukocyte transendothelial migration
    100924022 (PRKCB)
   04062 Chemokine signaling pathway
    100924022 (PRKCB)
  09152 Endocrine system
   04911 Insulin secretion
    100924022 (PRKCB)
   04929 GnRH secretion
    100924022 (PRKCB)
   04912 GnRH signaling pathway
    100924022 (PRKCB)
   04921 Oxytocin signaling pathway
    100924022 (PRKCB)
   04935 Growth hormone synthesis, secretion and action
    100924022 (PRKCB)
   04918 Thyroid hormone synthesis
    100924022 (PRKCB)
   04919 Thyroid hormone signaling pathway
    100924022 (PRKCB)
   04928 Parathyroid hormone synthesis, secretion and action
    100924022 (PRKCB)
   04916 Melanogenesis
    100924022 (PRKCB)
   04925 Aldosterone synthesis and secretion
    100924022 (PRKCB)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100924022 (PRKCB)
  09154 Digestive system
   04970 Salivary secretion
    100924022 (PRKCB)
   04971 Gastric acid secretion
    100924022 (PRKCB)
   04972 Pancreatic secretion
    100924022 (PRKCB)
   04973 Carbohydrate digestion and absorption
    100924022 (PRKCB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100924022 (PRKCB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100924022 (PRKCB)
  09156 Nervous system
   04724 Glutamatergic synapse
    100924022 (PRKCB)
   04727 GABAergic synapse
    100924022 (PRKCB)
   04725 Cholinergic synapse
    100924022 (PRKCB)
   04728 Dopaminergic synapse
    100924022 (PRKCB)
   04726 Serotonergic synapse
    100924022 (PRKCB)
   04720 Long-term potentiation
    100924022 (PRKCB)
   04730 Long-term depression
    100924022 (PRKCB)
   04723 Retrograde endocannabinoid signaling
    100924022 (PRKCB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100924022 (PRKCB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100924022 (PRKCB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100924022 (PRKCB)
   05206 MicroRNAs in cancer
    100924022 (PRKCB)
   05205 Proteoglycans in cancer
    100924022 (PRKCB)
   05231 Choline metabolism in cancer
    100924022 (PRKCB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100924022 (PRKCB)
   05214 Glioma
    100924022 (PRKCB)
   05223 Non-small cell lung cancer
    100924022 (PRKCB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100924022 (PRKCB)
   05161 Hepatitis B
    100924022 (PRKCB)
   05171 Coronavirus disease - COVID-19
    100924022 (PRKCB)
   05164 Influenza A
    100924022 (PRKCB)
   05163 Human cytomegalovirus infection
    100924022 (PRKCB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100924022 (PRKCB)
   05140 Leishmaniasis
    100924022 (PRKCB)
   05143 African trypanosomiasis
    100924022 (PRKCB)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100924022 (PRKCB)
   05022 Pathways of neurodegeneration - multiple diseases
    100924022 (PRKCB)
  09165 Substance dependence
   05031 Amphetamine addiction
    100924022 (PRKCB)
   05032 Morphine addiction
    100924022 (PRKCB)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100924022 (PRKCB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100924022 (PRKCB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100924022 (PRKCB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100924022 (PRKCB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100924022 (PRKCB)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100924022 (PRKCB)
Protein kinases [BR:shr01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100924022 (PRKCB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like CEP76-C2 APH Transpeptidase
Other DBs
NCBI-GeneID: 100924022
NCBI-ProteinID: XP_031801445
Ensembl: ENSSHAG00000008514
LinkDB
Position
1
AA seq 755 aa
MQMKGRSPAVSASRPRSCGQRCRAQLEERRQLGAVTARSSARLGGGGGATNRTAREGRPR
GPAAAVSSFPAPGTSPLFLARKMADPAAGPPPSEGEENTVRFARKGALRQKNVHEVKNHK
FTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDP
RSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTER
RGRIYIKAQIDKDVLTVVVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCS
LNPEWNETFKFQLKEADKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLL
SQEEGEYFNVPVPPEGEEGNEELRQKFERAKIGQGTKVTEEKTANAISKIDNNGNRDRMK
LTDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALAG
KPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYQIQQVGRFKEPHAVFYAAEIAIGLFFLQ
SKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPY
GKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTK
HPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKACGRNAENFDRFFTRHPP
VLTPPDQEVIRNIDQSEFEGFSFVNSEFLKPEVKS
NT seq 2268 nt   +upstreamnt  +downstreamnt
atgcaaatgaaggggcggtcccctgcggtctccgcctcccgcccccgcagctgtggacag
cggtgcagagcgcagctggaggagcgacggcagctgggggcagtgacagctcggagctcc
gctaggctaggcggcggcggcggggcgacaaaccgcacggcgagggaaggaagaccgcgc
ggcccggcagctgccgtctcctcattcccagcccctggtacctctccgctcttccttgcg
cgcaagatggctgacccggctgcggggccgccgccgagcgaaggcgaggagaacacggtc
cgcttcgcccgcaaaggggccctccggcagaagaacgtccacgaggtgaagaaccacaaa
ttcaccgctcgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctgg
ggattcggaaaacagggatttcagtgtcaagtgtgctgtttcgtagtccataagagatgc
catgaatttgtcaccttctcctgcccgggtgctgataagggcccagcctctgatgatcca
cggagcaagcacaagtttaaaattcatacttattccagtccaacattttgtgaccactgc
ggctctttgctgtatgggctcattcaccaaggaatgaaatgtgacacctgcatgatgaat
gtgcacaagcgctgtgtgatgaatgtccccagcctctgcggaacagaccacactgagcgt
cgaggacgaatctacatcaaggcccagattgataaagatgttctcactgttgttgtaaga
gatgcaaaaaatctagtccctatggatcctaatggtttatcagatccttatgtaaaactg
aaactcatccctgatcccaagagtgagagcaagcagaagaccaaaaccatcaagtgttcc
ctcaaccctgagtggaatgagacttttaaatttcaactgaaagaagctgacaaagacaga
cgactttctgtggagatttgggactgggatctgaccagcaggaatgacttcatggggtcc
ttgtcctttgggatttcagagctgcagaaagctggtgttgatggatggtttaagttacta
agtcaagaggaaggagagtattttaatgttccagttcctcctgaaggagaagaaggcaat
gaagagctcaggcagaaatttgagagagccaagattggccagggaaccaaggttaccgaa
gaaaaaacagccaatgcaatatctaaaattgacaacaatggaaaccgagatcggatgaaa
ctgactgattttaacttcctcatggtgctggggaaaggcagctttggcaaggtcatgctt
tcagaaagaaaaggcactgatgaactctatgctgtgaagatcctgaagaaagatgtagtg
atccaggatgatgatgtggaatgtacaatggtggagaagagggttcttgctcttgctggg
aaacctccattcctgacacagttgcactcctgtttccagacaatggatcgcttgtatttt
gtgatggaatatgtgaatggtggagatctcatgtatcagatacagcaggttggacgattt
aaagaaccacatgctgtattctatgcagcagaaattgctattggtctattcttcttacaa
agcaaaggcatcatttatcgagacctaaaacttgacaatgtaatgttggattctgaaggc
cacatcaagatcgctgactttggcatgtgcaaggagaacatttgggatggggtaaccacc
aagacattctgtggcaccccagactacattgctcctgagataattgcctatcagccttac
gggaagtcggtagattggtgggcttttggagtgctgctgtatgaaatgttggctggccag
gctccttttgaaggagaagatgaagatgagcttttccagtctatcatggagcacaatgtg
gcctaccccaagtccatgtcaaaagaagctgtggccatctgcaaagggctgatgaccaag
cacccaggtaaacgtctgggatgtggacctgaaggtgaacgagatattaaggaacatgca
tttttccggtatattgactgggagaaacttgaacgcaaggagattcagcccccatacaag
ccaaaggcttgtgggcgaaatgccgaaaacttcgaccggtttttcacccgccatccaccc
gtcctaacacctcctgaccaggaagtcatcaggaacattgaccaatcagaattcgaagga
ttttcctttgttaactctgaatttttaaaacctgaagtcaagagctaa

KEGG   Sarcophilus harrisii (Tasmanian devil): 100935225
Entry
100935225         CDS       T02286                                 

Gene name
PRKCG
Definition
(RefSeq) protein kinase C gamma type
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr04010  MAPK signaling pathway
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04015  Rap1 signaling pathway
shr04020  Calcium signaling pathway
shr04066  HIF-1 signaling pathway
shr04070  Phosphatidylinositol signaling system
shr04071  Sphingolipid signaling pathway
shr04150  mTOR signaling pathway
shr04270  Vascular smooth muscle contraction
shr04310  Wnt signaling pathway
shr04370  VEGF signaling pathway
shr04510  Focal adhesion
shr04540  Gap junction
shr04613  Neutrophil extracellular trap formation
shr04650  Natural killer cell mediated cytotoxicity
shr04666  Fc gamma R-mediated phagocytosis
shr04670  Leukocyte transendothelial migration
shr04713  Circadian entrainment
shr04720  Long-term potentiation
shr04723  Retrograde endocannabinoid signaling
shr04724  Glutamatergic synapse
shr04725  Cholinergic synapse
shr04726  Serotonergic synapse
shr04727  GABAergic synapse
shr04728  Dopaminergic synapse
shr04730  Long-term depression
shr04750  Inflammatory mediator regulation of TRP channels
shr04911  Insulin secretion
shr04916  Melanogenesis
shr04918  Thyroid hormone synthesis
shr04919  Thyroid hormone signaling pathway
shr04921  Oxytocin signaling pathway
shr04925  Aldosterone synthesis and secretion
shr04928  Parathyroid hormone synthesis, secretion and action
shr04929  GnRH secretion
shr04935  Growth hormone synthesis, secretion and action
shr04960  Aldosterone-regulated sodium reabsorption
shr04961  Endocrine and other factor-regulated calcium reabsorption
shr04970  Salivary secretion
shr04971  Gastric acid secretion
shr04972  Pancreatic secretion
shr05017  Spinocerebellar ataxia
shr05022  Pathways of neurodegeneration - multiple diseases
shr05031  Amphetamine addiction
shr05032  Morphine addiction
shr05143  African trypanosomiasis
shr05146  Amoebiasis
shr05161  Hepatitis B
shr05163  Human cytomegalovirus infection
shr05170  Human immunodeficiency virus 1 infection
shr05171  Coronavirus disease - COVID-19
shr05200  Pathways in cancer
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05214  Glioma
shr05223  Non-small cell lung cancer
shr05225  Hepatocellular carcinoma
shr05231  Choline metabolism in cancer
shr05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100935225 (PRKCG)
   04012 ErbB signaling pathway
    100935225 (PRKCG)
   04014 Ras signaling pathway
    100935225 (PRKCG)
   04015 Rap1 signaling pathway
    100935225 (PRKCG)
   04310 Wnt signaling pathway
    100935225 (PRKCG)
   04370 VEGF signaling pathway
    100935225 (PRKCG)
   04066 HIF-1 signaling pathway
    100935225 (PRKCG)
   04020 Calcium signaling pathway
    100935225 (PRKCG)
   04070 Phosphatidylinositol signaling system
    100935225 (PRKCG)
   04071 Sphingolipid signaling pathway
    100935225 (PRKCG)
   04150 mTOR signaling pathway
    100935225 (PRKCG)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100935225 (PRKCG)
   04540 Gap junction
    100935225 (PRKCG)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100935225 (PRKCG)
   04650 Natural killer cell mediated cytotoxicity
    100935225 (PRKCG)
   04666 Fc gamma R-mediated phagocytosis
    100935225 (PRKCG)
   04670 Leukocyte transendothelial migration
    100935225 (PRKCG)
  09152 Endocrine system
   04911 Insulin secretion
    100935225 (PRKCG)
   04929 GnRH secretion
    100935225 (PRKCG)
   04921 Oxytocin signaling pathway
    100935225 (PRKCG)
   04935 Growth hormone synthesis, secretion and action
    100935225 (PRKCG)
   04918 Thyroid hormone synthesis
    100935225 (PRKCG)
   04919 Thyroid hormone signaling pathway
    100935225 (PRKCG)
   04928 Parathyroid hormone synthesis, secretion and action
    100935225 (PRKCG)
   04916 Melanogenesis
    100935225 (PRKCG)
   04925 Aldosterone synthesis and secretion
    100935225 (PRKCG)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100935225 (PRKCG)
  09154 Digestive system
   04970 Salivary secretion
    100935225 (PRKCG)
   04971 Gastric acid secretion
    100935225 (PRKCG)
   04972 Pancreatic secretion
    100935225 (PRKCG)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100935225 (PRKCG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100935225 (PRKCG)
  09156 Nervous system
   04724 Glutamatergic synapse
    100935225 (PRKCG)
   04727 GABAergic synapse
    100935225 (PRKCG)
   04725 Cholinergic synapse
    100935225 (PRKCG)
   04728 Dopaminergic synapse
    100935225 (PRKCG)
   04726 Serotonergic synapse
    100935225 (PRKCG)
   04720 Long-term potentiation
    100935225 (PRKCG)
   04730 Long-term depression
    100935225 (PRKCG)
   04723 Retrograde endocannabinoid signaling
    100935225 (PRKCG)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100935225 (PRKCG)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100935225 (PRKCG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100935225 (PRKCG)
   05206 MicroRNAs in cancer
    100935225 (PRKCG)
   05205 Proteoglycans in cancer
    100935225 (PRKCG)
   05231 Choline metabolism in cancer
    100935225 (PRKCG)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100935225 (PRKCG)
   05214 Glioma
    100935225 (PRKCG)
   05223 Non-small cell lung cancer
    100935225 (PRKCG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100935225 (PRKCG)
   05161 Hepatitis B
    100935225 (PRKCG)
   05171 Coronavirus disease - COVID-19
    100935225 (PRKCG)
   05163 Human cytomegalovirus infection
    100935225 (PRKCG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100935225 (PRKCG)
   05143 African trypanosomiasis
    100935225 (PRKCG)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100935225 (PRKCG)
   05022 Pathways of neurodegeneration - multiple diseases
    100935225 (PRKCG)
  09165 Substance dependence
   05031 Amphetamine addiction
    100935225 (PRKCG)
   05032 Morphine addiction
    100935225 (PRKCG)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100935225 (PRKCG)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100935225 (PRKCG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100935225 (PRKCG)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100935225 (PRKCG)
Protein kinases [BR:shr01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100935225 (PRKCG)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 Pkinase_C C2 Kinase-like APH
Other DBs
NCBI-GeneID: 100935225
NCBI-ProteinID: XP_031817629
Ensembl: ENSSHAG00000008401
LinkDB
Position
3
AA seq 612 aa
MAGLGPGGGEVEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCASHPGPCRSSLKPGDVERRLSIEVWDWDRTSRNDFMGAMSFGVSELLKA
SVDGWYKLLNQEEGEYYNVPVADADNCGLLPKFEACNYPLELYERVRLGPSPSPSPSPSP
TDSKRCFFGSGSGSGRLHISDFTFLMVLGKGSFGKVMLAERRGSEELFAIKILKKDVIVQ
DDDVDCTLVEKRVLALGGRGLGGRPHFLTQLHSTFQTPDRLYFVMEYVTGGDLMYHIQQL
GKFKEPHAAFYAAEIAIGLFFLHNQGIIYRDLKLDNVMLDAEGHIKITDFGMCKENIFPG
TTTRTFCGTPDYIAPEIIAYQPYGKSVDWWSFGVLLYEMLAGQPPFDGEDEEELFQAIME
QTVTYPKALSREAVAVCKGFLTKHPGKRLGSGPEGEVAIRGHGFFRWIDWERLERLEIAP
PFRPRPCGRSGENFDKFFTRAAPALTPPDRLVLASIDQADFQGFTYVNPDFVHPDARELP
SPGAGASPVPVL
NT seq 1839 nt   +upstreamnt  +downstreamnt
atggctgggctgggcccgggaggtggggaggtggagggcggcccccggcccctgttttgc
aggaagggggctctgcgccagaaggtcgtgcatgaggtgaagagtcacaaattcacggcc
cgctttttcaagcagcccaccttctgcagccactgtacggacttcatctgggggatcggc
aaacagggccttcagtgtcaagtctgcagcttcgtggttcaccgacgatgccacgaattc
gtgaccttcgagtgtccgggcgcggggaaggggccgcagacagacgacccccgcaacaag
cacaagttccgcctgcacagctacagcagcccgaccttctgcgaccactgcggctccctg
ctctacgggctggtgcatcagggcatgaagtgcgcctcccaccctggtccgtgccgcagc
tccctgaagcccggggatgtggagcgccgcctgagcatcgaggtctgggactgggacagg
acgtctcgtaacgacttcatgggagccatgtcctttggcgtctcggagctgctcaaggcc
tctgtggacggctggtacaagttactgaaccaggaggagggtgaatattacaatgtccca
gtggccgacgctgacaactgcggccttctgcccaagtttgaggcctgtaactatcccctg
gagctgtatgagcgggtgcgcctgggcccttctccctccccctctccctcccccagcccc
acggactccaagcgctgcttcttcggctcgggctcgggctcgggccgcctgcacatctcc
gacttcaccttcctcatggtgcttggaaagggcagttttggcaaggtgatgctcgcggag
cgtcggggttccgaggagctgttcgccattaagatcctgaagaaggacgtgatcgtgcag
gacgacgacgtggactgcacgctggtggagaagcgcgtgctggccctggggggccgcggg
ctgggcggccggccgcactttctcacgcagctgcactccacttttcagacccccgaccga
ctgtactttgtgatggagtacgtgacgggcggggacctcatgtaccacatccagcagctg
ggcaagttcaaggaaccgcacgccgcgttctacgcggccgaaattgccatcggcctcttc
ttcctccacaaccagggcatcatctacagggacctgaagctggacaacgtgatgctggac
gcggaaggacacatcaagatcacggacttcggcatgtgcaaggagaacatcttcccgggg
accacgactcggaccttctgcgggaccccggactacatagctcccgagattatcgcctac
cagccctacggaaagtcggtggactggtggtccttcggggtgctgctctatgagatgctg
gcggggcagcctccgtttgacggggaggacgaggaagagctgtttcaggccatcatggag
cagacggtgacctacccgaaggcgctgtcgcgggaggccgtagccgtgtgcaaggggttt
ctcactaaacacccaggaaagcgtctgggctcggggcccgagggcgaggttgccatccgg
ggccatggcttcttccgctggattgactgggagcgcctagagaggctggagatcgctccg
cccttcaggccacgaccatgtggtcggagcggtgagaattttgacaagttcttcacccgc
gcggccccggcactgacgccccccgatcgcctggtcctggccagcatcgaccaagccgat
tttcaggggttcacctatgtcaaccctgactttgtgcatcccgatgcccgcgagctgccc
agtcccggggccggggccagccccgtgcctgtgctttga

DBGET integrated database retrieval system