KEGG   Sarcophilus harrisii (Tasmanian devil): 100914028
Entry
100914028         CDS       T02286                                 

Definition
(RefSeq) baculoviral IAP repeat-containing protein 2 isoform X1
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01524  Platinum drug resistance
shr04064  NF-kappa B signaling pathway
shr04120  Ubiquitin mediated proteolysis
shr04210  Apoptosis
shr04215  Apoptosis - multiple species
shr04217  Necroptosis
shr04390  Hippo signaling pathway
shr04510  Focal adhesion
shr04621  NOD-like receptor signaling pathway
shr04668  TNF signaling pathway
shr05132  Salmonella infection
shr05145  Toxoplasmosis
shr05168  Herpes simplex virus 1 infection
shr05200  Pathways in cancer
shr05202  Transcriptional misregulation in cancer
shr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100914028
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100914028
   04064 NF-kappa B signaling pathway
    100914028
   04668 TNF signaling pathway
    100914028
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100914028
   04215 Apoptosis - multiple species
    100914028
   04217 Necroptosis
    100914028
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100914028
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100914028
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100914028
   05202 Transcriptional misregulation in cancer
    100914028
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100914028
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100914028
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100914028
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100914028
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100914028
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:shr01002]
    100914028
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:shr04121]
    100914028
Peptidases and inhibitors [BR:shr01002]
 Peptidase inhibitors
  Family I32: IAP family
   100914028
Ubiquitin system [BR:shr04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100914028
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-RING_5 zf-C3HC4_2 DUF2039 TF_Otx zf-RING_UBOX
Other DBs
NCBI-GeneID: 100914028
NCBI-ProteinID: XP_023355251
LinkDB
Position
3
AA seq 601 aa
MNAVEDGVLLARLMNSDANEMKYDLSCELYRMSTYSTFPVNVPISERSLARAGFYYTGVN
DRVKCFCCGLMLDNWKQGDNAIDKHKQLYPSCAFIQNLIAVNLGSSQSTFSSSVNNATRS
LSSSSGQSGYFSGSYCSFPLEPVTSRAVEDLSPLNASPYSYSMSTEDARILTYQTWPLTF
LSPLDLARAGFYYIGPGDMVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENHIQETS
RFSVSNLSMQTHTARMKTFVTWPPQIPVHPEQLASAGFYYVGRNDDVKCFCCDGGLRCWE
SGDDPWVEHAKWFPRCEYLIRMKGQEFVDQVQARYPHLLEQLLSTSDAPGDESADLPIIH
FGPGENNSDDTVMMNTPVIKAALEMGFSRSLVKQIVQSKILTTGENYKTVNEVVSDLLNA
EDEKRKEEKERQAEEMASDDLTLIRKNRMALFQHLTCVLPILDSLLTSGVINEQEHDVIK
QKTQTSLQARELIDTILVKGNAAANIFKNCLKEIDSVLYNNLFVEKNMKYIPTEDVSGLP
MEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKECAPSLRKCPICRGIIKGTVRTFL
S
NT seq 1806 nt   +upstreamnt  +downstreamnt
atgaatgcggtagaggatggtgtgctgttagcacgtttgatgaatagtgatgcaaatgaa
atgaaatatgatttgtcatgtgaactctacagaatgtctacatattctactttcccagtc
aatgttccaatctcagaaaggagtcttgctcgggctggattttattacactggtgtgaac
gacagagttaaatgtttctgttgtggcttaatgctggataattggaaacaaggagacaat
gctattgacaaacataaacagctttatcccagctgtgcatttattcagaatttgatagca
gttaacctgggatcttctcagtccacattttcttcttcagtgaataatgccacacgttca
ttatcttccagttcaggacagagtggatatttcagtggttcttattgcagttttccactg
gagccagtgacttccagagcagttgaggacttgtcccctttgaatgccagcccctatagt
tattcaatgagtacggaggatgccagaattctcacttatcagacatggccattgacattt
ctgtcaccattagatctggcaagagctggtttttactacataggacctggagacatggta
gcttgctttgcttgtggtgggaaactgagtaattgggagccaaaagatgatgccatgtca
gaacatcgaagacattttcctaactgtcctttcctggagaatcacatccaagaaacatca
aggttcagtgtttctaatctgagcatgcaaacccacacagcccgtatgaaaacctttgtg
acctggccccctcaaattccagttcatccagagcagcttgcaagtgctggcttttattat
gtgggtcgaaatgatgatgtcaaatgcttttgctgtgatggtggactgaggtgttgggaa
tctggagatgatccttgggtggaacatgccaaatggtttccaaggtgtgaatacttgata
cgaatgaaaggacaagagtttgttgatcaagttcaagctaggtatcctcatctccttgaa
cagctgttgtcaacttctgatgctccaggggatgaaagtgctgatctaccaattattcat
tttggacctggagaaaataattctgacgatacagtcatgatgaacactccagtgattaaa
gctgctttggaaatgggctttagtagaagtctagtaaagcagattgtccagagtaaaatc
ttaacaactggagaaaactataaaacagtcaatgaagttgtatcagatctcctcaatgca
gaagatgaaaaaaggaaagaggagaaagagagacaagctgaagaaatggcatcagatgac
ctgacattaattcggaagaatagaatggctctgtttcagcatttgacctgtgtacttcct
atcctggatagtcttttaacatcgggtgtgattaatgagcaggaacatgatgttattaaa
caaaaaacacagacgtctctacaagcaagagaactgattgataccattttagtcaaagga
aatgctgcagccaatatttttaaaaactgtctcaaagaaattgattctgtgttgtataac
aatttatttgtggaaaagaacatgaagtatattccaacagaagatgtttcaggtcttcct
atggaagaacagcttaggagattacaggaagaaagaacatgtaaagtttgtatggacaaa
gaagtttctattgtatttattccttgtggtcatctggtagtatgtaaagaatgtgcacct
tctctaagaaaatgcccaatttgcaggggtataatcaaaggtacagttcgtacttttctt
tcatga

KEGG   Sarcophilus harrisii (Tasmanian devil): 100918596
Entry
100918596         CDS       T02286                                 

Gene name
BIRC7
Definition
(RefSeq) LOW QUALITY PROTEIN: baculoviral IAP repeat-containing protein 7
  KO
K16061  baculoviral IAP repeat-containing protein 7/8
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04120  Ubiquitin mediated proteolysis
shr04215  Apoptosis - multiple species
shr05145  Toxoplasmosis
shr05200  Pathways in cancer
shr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100918596 (BIRC7)
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    100918596 (BIRC7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100918596 (BIRC7)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100918596 (BIRC7)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100918596 (BIRC7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:shr01002]
    100918596 (BIRC7)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:shr04121]
    100918596 (BIRC7)
Peptidases and inhibitors [BR:shr01002]
 Peptidase inhibitors
  Family I32: IAP family
   100918596 (BIRC7)
Ubiquitin system [BR:shr04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100918596 (BIRC7)
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-RING_5 zf-RING_UBOX zf-RING_2 zf-C3HC4 Vps39_2 DUF2039
Other DBs
NCBI-GeneID: 100918596
NCBI-ProteinID: XP_012395079
Ensembl: ENSSHAG00000010237
LinkDB
Position
2
AA seq 434 aa
MAGSPVNADIQTSIIEIPVFTSQFFEREVTQLWRKQGDXRVQVDEPRMGSEASRRKTFQD
WPAEGPVSPQDLARAGFFYIGPQDRVQCFCCGGMLDNWTAGDSPILEHQRLFPKCQFALS
KHTGGLPDRNTSDSVDGQILSQLQRISEEEEGEGNETVLTTRPAYPDMGVEQIRLDSFHN
WPSASMVCPQQLARAGFFYTGQHDHVKCYYCDGGLRNWDRGDDPWREHAKWFPRCEFLLQ
SRGRAYVSSIQESSSLLDSWGHGEDPGEVDSTPSTPGSPGSQAWLAWPAWRQSTVVKSVL
QMGFEQSMVERLVLNKYRLATPASTSVSQLVSDLIQEEERSARETRAPAPMASESSAPRR
EEQLEQITEAGPLSTEQQLQQLKEERTCKVCMYQVVSIVFVPCGHLVCSECAPNLQQCPI
CRAAIRGSVRTFLS
NT seq 1305 nt   +upstreamnt  +downstreamnt
atggctgggtctcctgtgaatgcagacatccagacaagcataatagaaataccagttttc
acttcccaattttttgaaagggaggtcacacagctctggaggaaacagggagacnncaga
gtgcaagtggatgagcccagaatgggcagtgaggccagccgaagaaaaaccttccaagac
tggccagctgagggccctgtctctccccaggacctggccagagccggcttcttctacata
ggccctcaggacagggttcagtgtttctgctgtggtgggatgttggacaactggaccgct
ggagacagccccatcctagaacaccagaggcttttccccaagtgtcagtttgccctcagc
aagcatactggcggtctccctgacaggaacacttctgacagcgtagatgggcagattttg
agtcaattgcaaagaatatcagaggaagaagaaggggaaggaaatgagactgtcctgact
acgagacctgcctacccagatatgggagtagaacaaatccgcctggactcatttcacaac
tggccatctgcttcaatggtgtgccctcagcaactggccagagcaggctttttctacaca
ggccagcatgaccatgtgaagtgttactactgtgatgggggcctgaggaactgggatcga
ggggatgacccttggagggagcacgccaagtggttccctagatgtgaatttctgcttcaa
tccagaggcagggcctatgtcagtagcatccaggagtcctccagcctactagactcctgg
ggtcatggagaagatccaggagaggtagattccactccttctaccccaggtagcccagga
agccaggcttggctagcgtggccagcctggcggcaatccacagtggtaaaaagtgtgctg
cagatggggtttgaacagagcatggtggagaggttggttctgaataaatacaggctggct
accccagccagcacatcagtatctcagctggtctctgatctaatccaggaggaagagagg
agtgcaagagagaccagagcacctgctcccatggcatctgagtcaagtgcacccagaaga
gaagagcaacttgagcagatcacagaggcaggacccctgagcacggagcagcagttgcag
cagctaaaggaggagaggacatgcaaagtgtgcatgtaccaagtggtatccattgtcttt
gtcccctgcggccacttggtctgctcagagtgcgccccaaacctgcagcagtgccccatc
tgtcgagccgccatccgcggcagtgtcaggactttcctgtcctag

KEGG   Sarcophilus harrisii (Tasmanian devil): 100928240
Entry
100928240         CDS       T02286                                 

Gene name
XIAP
Definition
(RefSeq) E3 ubiquitin-protein ligase XIAP
  KO
K04725  E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01524  Platinum drug resistance
shr04064  NF-kappa B signaling pathway
shr04120  Ubiquitin mediated proteolysis
shr04210  Apoptosis
shr04215  Apoptosis - multiple species
shr04217  Necroptosis
shr04510  Focal adhesion
shr04621  NOD-like receptor signaling pathway
shr05145  Toxoplasmosis
shr05166  Human T-cell leukemia virus 1 infection
shr05200  Pathways in cancer
shr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100928240 (XIAP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100928240 (XIAP)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100928240 (XIAP)
   04215 Apoptosis - multiple species
    100928240 (XIAP)
   04217 Necroptosis
    100928240 (XIAP)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100928240 (XIAP)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100928240 (XIAP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100928240 (XIAP)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100928240 (XIAP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100928240 (XIAP)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100928240 (XIAP)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100928240 (XIAP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:shr01002]
    100928240 (XIAP)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:shr04121]
    100928240 (XIAP)
   03029 Mitochondrial biogenesis [BR:shr03029]
    100928240 (XIAP)
Enzymes [BR:shr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100928240 (XIAP)
Peptidases and inhibitors [BR:shr01002]
 Peptidase inhibitors
  Family I32: IAP family
   100928240 (XIAP)
Ubiquitin system [BR:shr04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100928240 (XIAP)
Mitochondrial biogenesis [BR:shr03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    100928240 (XIAP)
SSDB
Motif
Pfam: BIR zf-C3HC4_3 zf-C3HC Prok-RING_4 zf-RING_UBOX
Other DBs
NCBI-GeneID: 100928240
NCBI-ProteinID: XP_012408668
Ensembl: ENSSHAG00000016328
LinkDB
Position
X
AA seq 488 aa
MTSKACVPPDINQDENFVEEKNRLQTFANFPSSSPVSASTLARAGFIYTGEGDTVKCFSC
HAAVDRWQFGDSAVGRHRKVSPNCGFINGFCLDRNAPQVPNPIAPNCPYRVENCSVNLSH
FVLERPLETYKEYLLRRGQVIDVADTIFPRNPAMCSEEARLRSFRNWPEYIHLTPEELAS
AGLYYLGIDDQVQCFCCGGKLKNWEPCDRAMSEHRRHFPKCFFVLGRDVGNTPIKSTASL
DRSCPNPTYIPKNPAMADYEARLLSFATWVFSINKEQLAKAGFYAIGDRDKVTCFHCGGG
LSDWRPTEDPWEQHAKWYPGCKFLLEKKGQEYINDIHLKNSLDNSVASFGKRPSVTREIG
YIVLESPLVQDAMRMGFSFYEVTKTMEEKVKATGSNYQSLEVLVADLVNAEEARTRGASS
SSQKEISTEEQLRRLQEEKLCKICMDENIAVVFIPCGHLVTCKSCAEVIDKCPMCYTVIT
FKQKIFMS
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgacttctaaagcctgtgtgcctccagatatcaatcaagatgaaaattttgttgaggaa
aagaatagattacaaacatttgctaattttccgagtagtagcccagtttcagcatcaaca
ctggcacgagcaggttttatctatactggtgaaggagatactgtgaagtgctttagctgt
catgcagctgtagatagatggcagtttggagactcggcagttggaaggcataggaaagtt
tctccaaactgtggatttattaatggtttttgtttggacagaaatgctccacaggttcca
aatcccattgccccaaactgtccgtatagagttgaaaattgttcagtgaatttaagtcat
tttgttttggagaggccccttgaaacttacaaggaatatcttttgagaagagggcaggtc
attgatgtagcagataccatattcccaaggaatcctgctatgtgcagtgaagaagctaga
ctgagatcttttcgtaattggccagagtatattcaccttaccccagaagagttagcaagc
gctggactctattacttgggtattgatgatcaagtgcagtgtttttgctgtgggggcaaa
ttaaagaattgggaaccatgtgatcgggcaatgtctgaacacaggaggcatttccctaag
tgtttttttgttttgggacgggatgttggtaatactccaattaaaagtaccgccagtctt
gataggagttgtccaaacccaacctatatcccaaagaatccagctatggcagattatgaa
gcacgactcctttcttttgcaacatgggtattctcgattaacaaggagcagcttgcaaaa
gctggattttatgctatcggtgaccgtgataaagtaacatgctttcattgtggaggtgga
cttagtgattggagacccactgaagacccttgggagcaacatgctaagtggtatccagga
tgcaaatttctgttagaaaagaagggccaggaatatatcaacgatattcatttaaagaat
tcacttgacaattctgtggcatcatttggcaaaagaccatcagtaactagagaaattggt
tatattgtgttagaaagtcctttggtacaagatgcaatgcgaatgggtttcagtttttat
gaggttacaaaaaccatggaagaaaaggtaaaagcgactggaagcaactatcaatcactt
gaggttctagtagcagatctagtgaatgctgaggaagcacgtacaagaggagcatcaagt
tcatcacagaaagagattagtactgaagaacagctcaggcgtctgcaagaggaaaagttg
tgtaagatctgcatggatgagaacattgctgtcgttttcatcccttgtggacatctggtt
acttgtaaatcctgtgctgaagtaattgacaaatgtccgatgtgttatactgtcattact
ttcaagcaaaaaattttcatgtcctaa

KEGG   Sarcophilus harrisii (Tasmanian devil): 100933131
Entry
100933131         CDS       T02286                                 

Definition
(RefSeq) baculoviral IAP repeat-containing protein 3 isoform X1
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01524  Platinum drug resistance
shr04064  NF-kappa B signaling pathway
shr04120  Ubiquitin mediated proteolysis
shr04210  Apoptosis
shr04215  Apoptosis - multiple species
shr04217  Necroptosis
shr04390  Hippo signaling pathway
shr04510  Focal adhesion
shr04621  NOD-like receptor signaling pathway
shr04668  TNF signaling pathway
shr05132  Salmonella infection
shr05145  Toxoplasmosis
shr05168  Herpes simplex virus 1 infection
shr05200  Pathways in cancer
shr05202  Transcriptional misregulation in cancer
shr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100933131
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100933131
   04064 NF-kappa B signaling pathway
    100933131
   04668 TNF signaling pathway
    100933131
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100933131
   04215 Apoptosis - multiple species
    100933131
   04217 Necroptosis
    100933131
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100933131
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100933131
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100933131
   05202 Transcriptional misregulation in cancer
    100933131
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100933131
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100933131
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100933131
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100933131
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100933131
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:shr01002]
    100933131
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:shr04121]
    100933131
Peptidases and inhibitors [BR:shr01002]
 Peptidase inhibitors
  Family I32: IAP family
   100933131
Ubiquitin system [BR:shr04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100933131
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 TF_Otx DUF2039 zf-RING_UBOX
Other DBs
NCBI-GeneID: 100933131
NCBI-ProteinID: XP_031816931
Ensembl: ENSSHAG00000011782
LinkDB
Position
3
AA seq 637 aa
MENYKEFHFQVSSFILKPYRMHKTTSPEKDLSRFCSQNLMDILENSIFLLNMNTSNLCEL
KYDFSCELYRMSTYSTFPVNVPISERSLARAGFYYTGVNDRVKCFCCGLMLDNWKQGDNA
IDKHKQLYPSCAFIQNLIAVNLGSSQSTFSSSVNNATRSLSSSSGQSGYFSGSYCSFPLE
PVTSRAVEDLSPLNASPYNYSVNTEDARILTYQTWPLTFLSPLDLARAGFYYIGPGDMVA
CFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENHIQETSRFSVSNLSMQTHAARMKTFVT
WPPQIPVHPEQLASAGFYYVGCNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEYLIE
IKGQQFINQIQASYPHLLEQLLSTSDTPVDQSAELPIYFGPAENHSEDAVIMNTFVVKAA
LEMGFNRRLIKQTVKNKILTSGENYKTISDLVSDLLKGEDETKEEEKEIKEIESDDLSLI
RKNRMALFQHLTCVHPVLDGLLIATVINEQEYDVIKQKAQISLQVRELIDTILVKGNVAA
NIFKKCLRDVDPVLHENLFVEKNIKYIPAPDVSDLSVEEQLRRLQEERTCKVCMDKEVSV
VFIPCGHLVVCKECSSSLRKCPICRSTIKGTIRTFLS
NT seq 1914 nt   +upstreamnt  +downstreamnt
atggaaaattacaaagaatttcatttccaggtttctagcttcatattaaaaccatatagg
atgcacaaaactacctccccagagaaagacttgtcccgtttttgctcccagaatctcatg
gacattttagaaaatagcatattcttattgaatatgaatactagtaacctatgtgaattg
aaatatgacttttcttgtgaactctacagaatgtctacatattctactttcccagtcaat
gttccaatctcagaaaggagtcttgctcgggctggattttattacactggtgtgaacgac
agagttaaatgtttctgttgtggcttaatgctggataattggaaacaaggagacaatgct
attgacaaacataaacagctttatcccagctgtgcatttattcagaatttgatagcagtt
aacctgggatcttctcagtccacattttcttcttcagtgaataatgccacacgttcatta
tcttccagttcaggacagagtggatatttcagtggttcttattgcagttttccactggag
ccagtgacttccagagcagttgaggacttgtcccctttgaatgccagcccctacaattat
tcagtgaatacggaggatgccagaattctcacttatcagacatggccattgacatttctg
tcaccattagatctggcaagagctggtttttactacataggacctggagacatggtagct
tgctttgcttgtggtgggaaactgagtaattgggagccaaaagatgatgccatgtcagaa
catcgaagacattttcctaactgtcctttcctggagaatcacatccaagaaacatcaagg
ttcagtgtttctaatctgagcatgcaaacccacgcagcccgtatgaaaacctttgtgacc
tggccccctcaaattccagttcatccagagcagcttgcaagtgctggcttttattatgtg
ggttgcaatgatgatgtcaaatgcttttgctgtgatggtggattgagatgctgggaatct
ggagatgatccttgggtggagcatgccaaatggtttccaaggtgtgagtacttgatcgaa
ataaagggacaacaattcatcaatcaaattcaagctagttatccccatcttcttgaacag
ctgctatctacatcagatactccagtggatcaaagtgctgagttaccaatttattttgga
ccggcagaaaaccattcagaagatgcagtcattatgaatacatttgttgtcaaagcagct
ttggaaatgggctttaatagaagactaataaaacagacagttaaaaataaaatcttaaca
agtggagaaaactacaaaacaatcagtgatcttgtatcagatttacttaagggagaagat
gaaacaaaggaagaggaaaaagaaattaaagaaatagaatcagatgacttatcattaatt
cggaagaacagaatggcactgtttcaacatttgacctgtgtgcatcccgttctggatggc
ctattgattgccactgtgatcaatgaacaagaatacgatgttattaaacaaaaagcacag
atatctttgcaagtcagagaactgattgataccattttagttaaaggaaatgttgcggcc
aacatatttaaaaaatgtctcagagatgttgatccagtcttacatgagaatttgtttgtg
gaaaagaacataaagtatattccagcaccagatgtttcagacttgtcagtagaagaacag
ttgaggcgattacaagaagaaagaacatgcaaagtttgtatggacaaagaagtatcagtt
gtctttattccttgtggacacctagtagtttgcaaagaatgttcatcttctctaagaaaa
tgccctatttgtagaagtacaatcaagggtacaattcgtacatttctttcataa

DBGET integrated database retrieval system