KEGG   Sarcophilus harrisii (Tasmanian devil): 100914196
Entry
100914196         CDS       T02286                                 

Gene name
RB1
Definition
(RefSeq) retinoblastoma-associated protein
  KO
K06618  retinoblastoma-associated protein
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01522  Endocrine resistance
shr04110  Cell cycle
shr04218  Cellular senescence
shr04934  Cushing syndrome
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05163  Human cytomegalovirus infection
shr05165  Human papillomavirus infection
shr05166  Human T-cell leukemia virus 1 infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05169  Epstein-Barr virus infection
shr05200  Pathways in cancer
shr05203  Viral carcinogenesis
shr05212  Pancreatic cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05218  Melanoma
shr05219  Bladder cancer
shr05220  Chronic myeloid leukemia
shr05222  Small cell lung cancer
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100914196 (RB1)
   04218 Cellular senescence
    100914196 (RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100914196 (RB1)
   05203 Viral carcinogenesis
    100914196 (RB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100914196 (RB1)
   05225 Hepatocellular carcinoma
    100914196 (RB1)
   05226 Gastric cancer
    100914196 (RB1)
   05214 Glioma
    100914196 (RB1)
   05220 Chronic myeloid leukemia
    100914196 (RB1)
   05218 Melanoma
    100914196 (RB1)
   05219 Bladder cancer
    100914196 (RB1)
   05215 Prostate cancer
    100914196 (RB1)
   05224 Breast cancer
    100914196 (RB1)
   05222 Small cell lung cancer
    100914196 (RB1)
   05223 Non-small cell lung cancer
    100914196 (RB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100914196 (RB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100914196 (RB1)
   05161 Hepatitis B
    100914196 (RB1)
   05160 Hepatitis C
    100914196 (RB1)
   05163 Human cytomegalovirus infection
    100914196 (RB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100914196 (RB1)
   05169 Epstein-Barr virus infection
    100914196 (RB1)
   05165 Human papillomavirus infection
    100914196 (RB1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100914196 (RB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:shr01009]
    100914196 (RB1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:shr03000]
    100914196 (RB1)
Protein phosphatases and associated proteins [BR:shr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100914196 (RB1)
Transcription factors [BR:shr03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    100914196 (RB1)
SSDB
Motif
Pfam: Rb_C RB_A RB_B DUF3452
Other DBs
NCBI-GeneID: 100914196
NCBI-ProteinID: XP_031817788
Ensembl: ENSSHAG00000014024
LinkDB
Position
3
AA seq 931 aa
MPPKAPRKPAGAAPEPPPPPPPPPSPPPREQEPEPDSGADDLPPVRFEFEEAEDPDFIAL
CQKLKIPNHVRKKAWENWEKVSSMDGILECYIQKKKELWGICIFTAAIDLDEMPFTFTEL
QKRIDISVCKFYHLIREIDTSTKVDCTVSRLMKKYEVLFALYHKLERTCGLIYMAQPSSL
ISSEINSMLELKVSWNLFLLAKGKILQMEDDLVISFQLMLCVLDYCIKLSPPAVLREPYK
TAMSTLSINGSPRTPRRGQSRSARITRQPETDTRVIEILCKEHECNIDEVKNVYFKNFLP
FLKSLGIASSNGLPEVENLSKQYEEIYLKNKDIDARLFLDHDKTLQDDSVDSFEMERTPR
KNHPDEEMPLIPPQTPVRAVMNTIQQLVMILNSASDQPSENLISYFNNCTVNPKESILKR
VENIGRIFKEKFAEAVGQGCAEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLN
DNIFHTSLLACAVEVVMATYGRNTYQNHDSGTDLSFPWILNVLDLKAFDFYKVIESFIKA
EASLTREMIKHLERCEHRIMESLAWQSDSPLFDLIKQSKEREGPVDHLLEPTSTLNLPLQ
HNHTAADLYLSPVRSPKKKGSTARINSASNAEPQTTSASQTQKPPKSTSLSLFYKKVYRL
AYLRLNTLCSRLLSDHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNI
DLKFKIIVTAYKDLTHAIQETFKRVLIREGQYDSIIVFYNLVFMQKLKTNILQYASTRPP
TLSPIPHIPRSPYKFSSSPLRVPGGNIYISPLKSPYKFSEGLPTPTKMTPRSRILVSIGE
SFSTSEKFQKINQMVCSSDRLLKRSAEGSNPPKPLKKLRFDIEGADEADGSKHLPGESKF
QQKLAEMTSTRTRMQKQKMNNSMDTSSKEEK
NT seq 2796 nt   +upstreamnt  +downstreamnt
atgccgcctaaagcccctcggaaaccggctggtgccgctccggagccgccgccgccgccg
ccgccgccgccttcccctccccctcgggagcaggaaccggagccggacagcggcgcggac
gacctgccgccggtcaggtttgaatttgaagaagcagaagaccctgactttattgcatta
tgtcagaaactaaagataccaaatcatgtcaggaaaaaggcttgggagaattgggaaaaa
gtttcatctatggatggaattttggaatgttatattcaaaagaaaaaggaattgtgggga
atctgtatattcactgcagccatagacctggatgagatgccgttcacctttactgagctt
cagaaaaggatagatataagtgtgtgcaaattttatcatttgataagagaaattgatacc
agtactaaagttgactgtactgtatccaggctaatgaagaaatatgaagttttatttgcc
ctctaccacaaactggaaaggacatgtggacttatatatatggctcaacctagtagtctg
atatcttctgaaataaattctatgttggagctaaaagtatcttggaacttatttttgttg
gctaaaggtaaaatattacagatggaagatgatctggtgatttcatttcagttaatgttg
tgtgttcttgattattgtatcaaactctcacctcctgcagtgctcagagagccatataaa
actgcaatgagtacattatctattaatggttcacccagaacaccaaggcgaggtcaaagc
agaagtgcacggatcactagacaaccagaaactgacacaagggtcattgaaattctttgt
aaagagcatgaatgtaatatagatgaggtaaaaaatgtatatttcaaaaactttctacca
ttcctgaagtctcttggtattgcatcttctaatggactaccagaggttgaaaatctctct
aaacaatatgaagaaatttaccttaaaaacaaagatatagatgcaagactttttctggac
catgataaaactcttcaagatgattctgttgatagttttgaaatggaaagaacaccaaga
aaaaatcatcctgatgaagagatgcctttaattcctccacagactcctgtgagggctgtc
atgaatactatccaacagttggtgatgatactaaattcagcaagtgatcagccatcagaa
aatcttatttcttatttcaataattgcacagtcaatcctaaggaaagtatcctgaaaaga
gtagagaatattggacgcatctttaaagagaaatttgcagaggctgttggccagggatgt
gcagaaattgggtcacagcgatacaaacttggagtgcgattatactacagagttatggaa
tctatgcttaaatcagaagaagagcgtttatctattcaaaacttcagcaaacttctgaat
gataacatcttccatacatctcttttggcttgtgctgtcgaggttgttatggccacatat
gggaggaatacataccagaatcatgattccggaacagatttgtcttttccatggattctg
aatgtacttgatttaaaagcatttgatttttataaagtgattgaaagctttatcaaggca
gaagctagtttgacaagggaaatgataaaacatttagagcgttgtgaacatcggatcatg
gaatcattagcatggcaatcagattcacctttatttgatctcattaaacaatcaaaggaa
cgagaaggaccagttgatcacctccttgaaccaacttctactcttaatctgcctctccaa
cataatcacactgctgcagatctgtatctttctcctgtaagatcccccaagaaaaaagga
tcaacagctcgaataaattctgcttcaaatgcagagccacagacaacatcagcctctcaa
actcagaagccaccgaaatctacctccctttcactcttttataaaaaagtgtatcggttg
gcatatctccggctgaatactttatgttcacgacttctgtcagatcacccagaactggag
cacatcatttggacccttttccaacatacattgcaaaatgagtatgaactcatgagggat
aggcatttggatcagattatgatgtgctccatgtatggcatatgcaaagtgaaaaatata
gatcttaaattcaaaatcattgtgacagcatacaaggaccttacccatgccatccaggag
actttcaaacgtgttttgatcagagaagggcaatatgattccatcatagtcttctacaat
ttggtcttcatgcagaaactgaaaacaaatattctacaatatgcatccaccaggccccca
accttatcaccgatacctcacattcctcggagtccttataagttttctagttctccttta
cgtgttcctggagggaatatttatatatcacccttgaaaagtccatacaaattttcagaa
ggtcttccaactcccacaaaaatgactccaagatcaagaattttggtttcaattggtgaa
tcatttagtacttctgagaagtttcagaaaataaaccagatggtatgtagcagtgaccgt
ttgctcaagagaagtgctgaaggaagcaatcctcctaagccacttaaaaaactacgcttt
gatattgaaggagcagatgaagcagatggaagcaaacatctccctggggaatctaaattt
caacaaaaacttgcagaaatgacatctactcgtacaagaatgcaaaaacagaaaatgaac
aatagcatggatacctcaagcaaggaagaaaagtga

DBGET integrated database retrieval system