KEGG   Sarcophilus harrisii (Tasmanian devil): 100917568
Entry
100917568         CDS       T02286                                 

Gene name
PDPK1
Definition
(RefSeq) 3-phosphoinositide-dependent protein kinase 1 isoform X1
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01524  Platinum drug resistance
shr03320  PPAR signaling pathway
shr04068  FoxO signaling pathway
shr04071  Sphingolipid signaling pathway
shr04140  Autophagy - animal
shr04150  mTOR signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04152  AMPK signaling pathway
shr04210  Apoptosis
shr04510  Focal adhesion
shr04660  T cell receptor signaling pathway
shr04664  Fc epsilon RI signaling pathway
shr04722  Neurotrophin signaling pathway
shr04910  Insulin signaling pathway
shr04919  Thyroid hormone signaling pathway
shr04931  Insulin resistance
shr04960  Aldosterone-regulated sodium reabsorption
shr05145  Toxoplasmosis
shr05205  Proteoglycans in cancer
shr05213  Endometrial cancer
shr05215  Prostate cancer
shr05223  Non-small cell lung cancer
shr05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100917568 (PDPK1)
   04071 Sphingolipid signaling pathway
    100917568 (PDPK1)
   04151 PI3K-Akt signaling pathway
    100917568 (PDPK1)
   04152 AMPK signaling pathway
    100917568 (PDPK1)
   04150 mTOR signaling pathway
    100917568 (PDPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100917568 (PDPK1)
  09143 Cell growth and death
   04210 Apoptosis
    100917568 (PDPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100917568 (PDPK1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100917568 (PDPK1)
   04664 Fc epsilon RI signaling pathway
    100917568 (PDPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100917568 (PDPK1)
   03320 PPAR signaling pathway
    100917568 (PDPK1)
   04919 Thyroid hormone signaling pathway
    100917568 (PDPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100917568 (PDPK1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100917568 (PDPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100917568 (PDPK1)
   05231 Choline metabolism in cancer
    100917568 (PDPK1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100917568 (PDPK1)
   05213 Endometrial cancer
    100917568 (PDPK1)
   05223 Non-small cell lung cancer
    100917568 (PDPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100917568 (PDPK1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100917568 (PDPK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100917568 (PDPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100917568 (PDPK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:shr04131]
    100917568 (PDPK1)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100917568 (PDPK1)
Protein kinases [BR:shr01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   100917568 (PDPK1)
Membrane trafficking [BR:shr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    100917568 (PDPK1)
SSDB
Motif
Pfam: Pkinase PH_3 PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH FTA2 Kdo
Other DBs
NCBI-GeneID: 100917568
NCBI-ProteinID: XP_031801524
Ensembl: ENSSHAG00000007805
LinkDB
Position
1
AA seq 558 aa
MARTTSQIYDAIPIQTSVVLCSCPTPSMVRNHTDSSTPPVIVPCSSRQGSTMDGTTAEPR
SNSNSLPQHSGQQLPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRH
IIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSF
DETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPDSKQA
RANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKL
EYDFPEKFFPKAKDLVEKLLVLDSTKRLGCEEMDGYGPLKDHSFFESITWEDLHHQTPPK
LTAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSTSSHSLSASETSLPQRSGSNIDQYIH
DLDNNSFELDLQFSEDEKKLLLEKQASGNPWHQFVENNLILKMGPVDKRKGLFARRRQLL
LTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCK
KIHEVWRHRYQNHPNTAV
NT seq 1677 nt   +upstreamnt  +downstreamnt
atggccagaaccacgagccagatctatgatgctattcccatacaaactagtgtggtatta
tgttcctgtccaactccatcaatggtgagaaaccatacagattccagcactccccctgtc
atcgttccctgtagtagcagacaggggtctacaatggatggcactacagctgagccaagg
tctaattccaattccttaccacaacattcaggacagcagctaccacagcctcgaaagaaa
cggccagaagacttcaagtttggaaaaatccttggtgaaggatctttctcaacagttgtc
ttggcccgggaattggcaacttctagagaatatgctattaaaatcctagagaaacggcat
atcataaaagagaacaaggtaccatatgtaaccagagaaagagatgtaatgtcccgcctg
gatcaccctttctttgtaaaactttacttcacatttcaggacgatgaaaagctgtatttt
ggccttagttatgccaaaaatggagagctacttaaatatattcgaaagattggttctttt
gatgagacttgcaccagattttatactgctgaaattgtgtctgctttagaatatttgcat
ggaaagggaattattcacagggaccttaaaccagagaacattttattaaatgaagatatg
cacattcagattacagattttggaacagcaaaagtattatctccagatagtaaacaagcc
agggctaattcatttgtaggaacagcacaatatgtttctccagagctgcttacagaaaaa
tcagcatgtaaaagttcagacctctgggctctcggatgtataatatatcaacttgtagca
ggattaccaccatttagagcaggaaatgaatatcttatatttcagaagataattaaattg
gaatatgactttccagaaaaattctttcctaaggcaaaagatcttgtggaaaaactttta
gttttagattccacaaagcgattaggctgtgaagaaatggatgggtatggaccccttaaa
gatcactcattctttgaatctataacatgggaggatctacatcatcagacgcccccaaag
ctgacagcatacttacctgctatgtctgaagatgatgaagactgctatggaaattatgac
aatcttctaagccaatttggctgcatgcaagtttcatcttcgacttcttcacattcatta
tctgcttcggagactagtctgccccagagatcaggcagcaatattgaccaatacattcat
gatctggacaataattcttttgagctggacttacagttttctgaggatgagaagaaatta
ttattggagaagcaggccagtggaaacccatggcaccaatttgtagaaaacaacttgata
ctaaaaatgggtccagtagataaacgaaagggtttatttgcacgccgtcgtcagttgctc
cttacagaaggaccacatttgtattatgtggaccctgtcaacaaagttttgaaaggagag
attccttggtcacaagaacttcggccagaagccaagaattttaagaccttttttgttcac
acacctaacaggacatattacctgatggacccaagtgggaatgctcataagtggtgcaaa
aagatacatgaagtttggcggcacagataccagaaccatccgaatactgctgtctag

DBGET integrated database retrieval system