KEGG   Sarcophilus harrisii (Tasmanian devil): 100917619
Entry
100917619         CDS       T02286                                 

Gene name
NFKB1
Definition
(RefSeq) nuclear factor NF-kappa-B p105 subunit isoform X1
  KO
K02580  nuclear factor NF-kappa-B p105 subunit
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01523  Antifolate resistance
shr04010  MAPK signaling pathway
shr04014  Ras signaling pathway
shr04024  cAMP signaling pathway
shr04062  Chemokine signaling pathway
shr04064  NF-kappa B signaling pathway
shr04066  HIF-1 signaling pathway
shr04071  Sphingolipid signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04210  Apoptosis
shr04211  Longevity regulating pathway
shr04218  Cellular senescence
shr04380  Osteoclast differentiation
shr04620  Toll-like receptor signaling pathway
shr04621  NOD-like receptor signaling pathway
shr04622  RIG-I-like receptor signaling pathway
shr04623  Cytosolic DNA-sensing pathway
shr04625  C-type lectin receptor signaling pathway
shr04657  IL-17 signaling pathway
shr04658  Th1 and Th2 cell differentiation
shr04659  Th17 cell differentiation
shr04660  T cell receptor signaling pathway
shr04662  B cell receptor signaling pathway
shr04668  TNF signaling pathway
shr04722  Neurotrophin signaling pathway
shr04917  Prolactin signaling pathway
shr04920  Adipocytokine signaling pathway
shr04926  Relaxin signaling pathway
shr04931  Insulin resistance
shr04932  Non-alcoholic fatty liver disease
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr05010  Alzheimer disease
shr05022  Pathways of neurodegeneration - multiple diseases
shr05030  Cocaine addiction
shr05132  Salmonella infection
shr05133  Pertussis
shr05134  Legionellosis
shr05135  Yersinia infection
shr05140  Leishmaniasis
shr05142  Chagas disease
shr05145  Toxoplasmosis
shr05146  Amoebiasis
shr05152  Tuberculosis
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05162  Measles
shr05163  Human cytomegalovirus infection
shr05164  Influenza A
shr05165  Human papillomavirus infection
shr05166  Human T-cell leukemia virus 1 infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05168  Herpes simplex virus 1 infection
shr05169  Epstein-Barr virus infection
shr05170  Human immunodeficiency virus 1 infection
shr05171  Coronavirus disease - COVID-19
shr05200  Pathways in cancer
shr05202  Transcriptional misregulation in cancer
shr05203  Viral carcinogenesis
shr05206  MicroRNAs in cancer
shr05212  Pancreatic cancer
shr05215  Prostate cancer
shr05220  Chronic myeloid leukemia
shr05221  Acute myeloid leukemia
shr05222  Small cell lung cancer
shr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
shr05321  Inflammatory bowel disease
shr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100917619 (NFKB1)
   04014 Ras signaling pathway
    100917619 (NFKB1)
   04064 NF-kappa B signaling pathway
    100917619 (NFKB1)
   04668 TNF signaling pathway
    100917619 (NFKB1)
   04066 HIF-1 signaling pathway
    100917619 (NFKB1)
   04071 Sphingolipid signaling pathway
    100917619 (NFKB1)
   04024 cAMP signaling pathway
    100917619 (NFKB1)
   04151 PI3K-Akt signaling pathway
    100917619 (NFKB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100917619 (NFKB1)
   04218 Cellular senescence
    100917619 (NFKB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100917619 (NFKB1)
   04621 NOD-like receptor signaling pathway
    100917619 (NFKB1)
   04622 RIG-I-like receptor signaling pathway
    100917619 (NFKB1)
   04623 Cytosolic DNA-sensing pathway
    100917619 (NFKB1)
   04625 C-type lectin receptor signaling pathway
    100917619 (NFKB1)
   04660 T cell receptor signaling pathway
    100917619 (NFKB1)
   04658 Th1 and Th2 cell differentiation
    100917619 (NFKB1)
   04659 Th17 cell differentiation
    100917619 (NFKB1)
   04657 IL-17 signaling pathway
    100917619 (NFKB1)
   04662 B cell receptor signaling pathway
    100917619 (NFKB1)
   04062 Chemokine signaling pathway
    100917619 (NFKB1)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100917619 (NFKB1)
   04917 Prolactin signaling pathway
    100917619 (NFKB1)
   04926 Relaxin signaling pathway
    100917619 (NFKB1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100917619 (NFKB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100917619 (NFKB1)
  09149 Aging
   04211 Longevity regulating pathway
    100917619 (NFKB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100917619 (NFKB1)
   05202 Transcriptional misregulation in cancer
    100917619 (NFKB1)
   05206 MicroRNAs in cancer
    100917619 (NFKB1)
   05203 Viral carcinogenesis
    100917619 (NFKB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100917619 (NFKB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100917619 (NFKB1)
   05221 Acute myeloid leukemia
    100917619 (NFKB1)
   05220 Chronic myeloid leukemia
    100917619 (NFKB1)
   05215 Prostate cancer
    100917619 (NFKB1)
   05222 Small cell lung cancer
    100917619 (NFKB1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100917619 (NFKB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100917619 (NFKB1)
   05022 Pathways of neurodegeneration - multiple diseases
    100917619 (NFKB1)
  09165 Substance dependence
   05030 Cocaine addiction
    100917619 (NFKB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100917619 (NFKB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100917619 (NFKB1)
   04931 Insulin resistance
    100917619 (NFKB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100917619 (NFKB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100917619 (NFKB1)
   05135 Yersinia infection
    100917619 (NFKB1)
   05133 Pertussis
    100917619 (NFKB1)
   05134 Legionellosis
    100917619 (NFKB1)
   05152 Tuberculosis
    100917619 (NFKB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100917619 (NFKB1)
   05170 Human immunodeficiency virus 1 infection
    100917619 (NFKB1)
   05161 Hepatitis B
    100917619 (NFKB1)
   05160 Hepatitis C
    100917619 (NFKB1)
   05171 Coronavirus disease - COVID-19
    100917619 (NFKB1)
   05164 Influenza A
    100917619 (NFKB1)
   05162 Measles
    100917619 (NFKB1)
   05168 Herpes simplex virus 1 infection
    100917619 (NFKB1)
   05163 Human cytomegalovirus infection
    100917619 (NFKB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100917619 (NFKB1)
   05169 Epstein-Barr virus infection
    100917619 (NFKB1)
   05165 Human papillomavirus infection
    100917619 (NFKB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100917619 (NFKB1)
   05145 Toxoplasmosis
    100917619 (NFKB1)
   05140 Leishmaniasis
    100917619 (NFKB1)
   05142 Chagas disease
    100917619 (NFKB1)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100917619 (NFKB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:shr03000]
    100917619 (NFKB1)
Transcription factors [BR:shr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    100917619 (NFKB1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer Ank_2 Ank_4 Ank Ank_3 Ank_5 Death HTH_11
Other DBs
NCBI-GeneID: 100917619
NCBI-ProteinID: XP_012407473
Ensembl: ENSSHAG00000007374
UniProt: G3VZA9
LinkDB
Position
6
AA seq 980 aa
MAEEDHYILRMHEQMFQMEPYNIGINAILNSSGLLPADIPLPTADGPYLQILEQPKQRGF
RFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKHVHLHAHSLVG
KHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVYETLEARMTDACIRGYNPGLLVHPEL
NYLQPEGGGERQLTDREKEIIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVV
SDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWE
GFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKD
KEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMYGGGGGGGGSGSAGPGYGFAPYGFSYGG
IPFHPGTTKSNAGMKHETLDSSYEQDHERCDKSDDRDSTEISEKVLQTTEQEDKSRVTGE
DEVSLTCTVGVEEEDCRLQGDLFLEKAMQLAKRHASALFDYAVTGDVKMLLAVQCHLTAV
QDDNGDNVLHLAIIHLHAELVRNLLEVISGLISDDIINMRNDLYQTPLHLAVITKQEDVV
EDLLRAGADVSLLDRLGNSVLHLAAKEGDDKILSILLKHGKISSLINLPNGEGLNAIHLA
MLINSMPCLRLMIAAGADVNAQEQTSGRTALHLAVEQENVSLAGCLLLEGDAYVDSTTYD
GTTPLHIAAGRGSTKLAALLKAAGADPLLENFEPLFDLDDAWEQDGEDEGVVPGTTPLDM
AANSQVYDILNGKPYQSESTSSDLLVQGDMKQLNEDAKLQLYKLLEMPDPDKNWSTLAQK
LGLGILNNAFRLSPAPSKTLMDNYEVSGGTIRELVDALREMGYTEAIEVIQEASNASVNP
SEIKEQPVKQIYSLPPSPSSIRQQLGEYKLQDNENVYDSGVETSFHKLSFTESLTSPGSL
ITLNKMSREYGQEASIEGKV
NT seq 2943 nt   +upstreamnt  +downstreamnt
atggcagaagaggatcattacattttgagaatgcatgaacaaatgtttcaaatggaacct
tataacattgggataaatgcaattcttaatagttcaggattacttccagcagacatacca
ttgccaacagcagatggtccctatcttcaaatattagagcaacctaaacagagggggttt
cgtttccgttatgtgtgtgaaggaccatctcatggaggacttcctggtgcgtctagtgaa
aagaacaagaaatcatatccccaagttaaaatttgcaactatgtggggccagcaaaagtt
attgtccaattggtcaccaatgggaagcatgtccacctgcatgctcacagcctggtaggg
aagcactgtgaggatggcatctgtactgtaactgctggacccaaggacatggtggtgggg
tttgcaaatctgggtatacttcatgtgacaaagaaaaaggtatatgaaacattggaagca
cggatgacagatgcctgtataagggggtataatcctggacttttagtgcatccagaactc
aactatttgcagccagaaggtggtggagaaagacaactcacagatagggaaaaagagatc
attcggcaggcagctctccagcagacaaaagagatggatctcagcgtggtccgactgatg
ttcacagcctttcttccagatagcacaggcagctttacaagaagactagagcctgtagtt
tcagatgcaatctatgacagcaaagcccccaatgcctcaaacttgaagattgtaagaatg
gacaggactgcaggctgtgttactggaggagaggagatttatcttctttgtgataaggtt
cagaaagatgacatccaaattcgattttatgaagaagaggagaatggaggagtctgggaa
ggctttggggatttttctcccacagatgttcacagacagtttgccattgtattcaaaact
ccaaagtataaagatgtcaatattaccaagccagcctctgtatttgtccaacttcggcgg
aaatctgacttggaaaccagtgagccaaagccttttctgtactacccagaaattaaagat
aaggaggaagtacaaagaaaacggcaaaaactcatgcctaatttttcggatagttttggt
ggtgggagtggcgctggagcaggaggaggagggatgtatggtggtggcggtggaggtggt
ggaagtggaagtgctggcccaggatatggctttgctccctatggattttcttatggtgga
attcctttccatcctggcacaaccaagtctaatgctggaatgaaacatgaaactttagac
tcctcatatgagcaagaccatgaacgttgcgacaagagtgatgacagggactctacagaa
atttctgagaaagtactacaaaccacagagcaagaagataaatccagagtcactggggaa
gatgaggtttctttgacatgtacagtaggagtggaggaggaagattgtaggttgcagggt
gaccttttcctagagaaggccatgcagcttgctaaacggcatgctagtgctctctttgac
tacgcagtgactggcgatgtgaagatgttactagctgtccagtgccatcttactgcagtt
caggatgacaatggggacaatgtcttacacttagcaatcatccaccttcatgctgaattg
gtacggaaccttttagaagtgatatctggtttgatttctgatgatatcattaacatgaga
aatgatctctatcagactcccttgcacttagcagtcatcaccaagcaggaagatgtggtg
gaggatctattgagggctggagctgatgtgagccttctggaccgcctgggtaactcagtt
ttacacttagctgcaaaggaaggagatgacaaaattctgagcatattactaaagcacgga
aagatatcatcacttatcaatcttcccaatggtgaaggcttgaatgcgattcacctggcc
atgctaatcaacagtatgccctgccttcggctaatgattgctgctggagcagatgtcaat
gctcaggaacagacgtctgggcgaactgccctgcatctggctgttgaacaagagaatgtg
tctttggctggctgcctgttattggagggtgatgcctatgtagacagcacaacatatgat
ggaaccactccccttcatattgctgctggacgagggtccacaaaattggcagctcttctc
aaagcagcgggtgcagaccctcttttggagaactttgaacctctgtttgacttggatgat
gcttgggaacaggatggagaagatgagggagtagttcctgggactacacctctggatatg
gcagccaactcacaggtgtatgacatattaaatggaaaaccatatcaatcagagtcaaca
tccagtgatttactggtacaaggagatatgaaacagctgaatgaagatgcaaagttgcag
ctttataaattattagaaatgcctgatccagacaaaaactggtctactctggcacagaaa
ttaggtctgggaattcttaacaatgccttccgactgagtcctgctccttccaaaactcta
atggacaactatgaggtctctgggggaacaataagggaactggtggatgctctgagagaa
atgggctatactgaagcaattgaagtcatccaggaggcctccaatgcctcagtaaatcca
tctgaaatcaaagagcagcctgtgaagcagatatattcgctgcccccatcaccttcctcc
ataagacagcagctaggtgaatataaactccaagataatgaaaatgtctatgacagtggg
gtggagacctccttccataaactcagctttactgagtctctgaccagccctggttcattg
ataacactcaacaaaatgtctcgtgaatatggacaggaagcatcaatcgaaggcaaggtt
taa

KEGG   Sarcophilus harrisii (Tasmanian devil): 100932473
Entry
100932473         CDS       T02286                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01523  Antifolate resistance
shr04010  MAPK signaling pathway
shr04014  Ras signaling pathway
shr04024  cAMP signaling pathway
shr04062  Chemokine signaling pathway
shr04064  NF-kappa B signaling pathway
shr04066  HIF-1 signaling pathway
shr04071  Sphingolipid signaling pathway
shr04137  Mitophagy - animal
shr04151  PI3K-Akt signaling pathway
shr04210  Apoptosis
shr04211  Longevity regulating pathway
shr04218  Cellular senescence
shr04380  Osteoclast differentiation
shr04620  Toll-like receptor signaling pathway
shr04621  NOD-like receptor signaling pathway
shr04622  RIG-I-like receptor signaling pathway
shr04623  Cytosolic DNA-sensing pathway
shr04625  C-type lectin receptor signaling pathway
shr04657  IL-17 signaling pathway
shr04658  Th1 and Th2 cell differentiation
shr04659  Th17 cell differentiation
shr04660  T cell receptor signaling pathway
shr04662  B cell receptor signaling pathway
shr04668  TNF signaling pathway
shr04722  Neurotrophin signaling pathway
shr04917  Prolactin signaling pathway
shr04920  Adipocytokine signaling pathway
shr04926  Relaxin signaling pathway
shr04931  Insulin resistance
shr04932  Non-alcoholic fatty liver disease
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr05010  Alzheimer disease
shr05022  Pathways of neurodegeneration - multiple diseases
shr05030  Cocaine addiction
shr05132  Salmonella infection
shr05133  Pertussis
shr05134  Legionellosis
shr05135  Yersinia infection
shr05140  Leishmaniasis
shr05142  Chagas disease
shr05145  Toxoplasmosis
shr05146  Amoebiasis
shr05152  Tuberculosis
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05162  Measles
shr05163  Human cytomegalovirus infection
shr05164  Influenza A
shr05165  Human papillomavirus infection
shr05166  Human T-cell leukemia virus 1 infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05168  Herpes simplex virus 1 infection
shr05169  Epstein-Barr virus infection
shr05170  Human immunodeficiency virus 1 infection
shr05171  Coronavirus disease - COVID-19
shr05200  Pathways in cancer
shr05202  Transcriptional misregulation in cancer
shr05203  Viral carcinogenesis
shr05212  Pancreatic cancer
shr05215  Prostate cancer
shr05220  Chronic myeloid leukemia
shr05221  Acute myeloid leukemia
shr05222  Small cell lung cancer
shr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
shr05321  Inflammatory bowel disease
shr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100932473 (RELA)
   04014 Ras signaling pathway
    100932473 (RELA)
   04064 NF-kappa B signaling pathway
    100932473 (RELA)
   04668 TNF signaling pathway
    100932473 (RELA)
   04066 HIF-1 signaling pathway
    100932473 (RELA)
   04071 Sphingolipid signaling pathway
    100932473 (RELA)
   04024 cAMP signaling pathway
    100932473 (RELA)
   04151 PI3K-Akt signaling pathway
    100932473 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100932473 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    100932473 (RELA)
   04218 Cellular senescence
    100932473 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100932473 (RELA)
   04621 NOD-like receptor signaling pathway
    100932473 (RELA)
   04622 RIG-I-like receptor signaling pathway
    100932473 (RELA)
   04623 Cytosolic DNA-sensing pathway
    100932473 (RELA)
   04625 C-type lectin receptor signaling pathway
    100932473 (RELA)
   04660 T cell receptor signaling pathway
    100932473 (RELA)
   04658 Th1 and Th2 cell differentiation
    100932473 (RELA)
   04659 Th17 cell differentiation
    100932473 (RELA)
   04657 IL-17 signaling pathway
    100932473 (RELA)
   04662 B cell receptor signaling pathway
    100932473 (RELA)
   04062 Chemokine signaling pathway
    100932473 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100932473 (RELA)
   04917 Prolactin signaling pathway
    100932473 (RELA)
   04926 Relaxin signaling pathway
    100932473 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100932473 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100932473 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    100932473 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100932473 (RELA)
   05202 Transcriptional misregulation in cancer
    100932473 (RELA)
   05203 Viral carcinogenesis
    100932473 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100932473 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100932473 (RELA)
   05221 Acute myeloid leukemia
    100932473 (RELA)
   05220 Chronic myeloid leukemia
    100932473 (RELA)
   05215 Prostate cancer
    100932473 (RELA)
   05222 Small cell lung cancer
    100932473 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100932473 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100932473 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    100932473 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    100932473 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100932473 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100932473 (RELA)
   04931 Insulin resistance
    100932473 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100932473 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100932473 (RELA)
   05135 Yersinia infection
    100932473 (RELA)
   05133 Pertussis
    100932473 (RELA)
   05134 Legionellosis
    100932473 (RELA)
   05152 Tuberculosis
    100932473 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100932473 (RELA)
   05170 Human immunodeficiency virus 1 infection
    100932473 (RELA)
   05161 Hepatitis B
    100932473 (RELA)
   05160 Hepatitis C
    100932473 (RELA)
   05171 Coronavirus disease - COVID-19
    100932473 (RELA)
   05164 Influenza A
    100932473 (RELA)
   05162 Measles
    100932473 (RELA)
   05168 Herpes simplex virus 1 infection
    100932473 (RELA)
   05163 Human cytomegalovirus infection
    100932473 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100932473 (RELA)
   05169 Epstein-Barr virus infection
    100932473 (RELA)
   05165 Human papillomavirus infection
    100932473 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100932473 (RELA)
   05145 Toxoplasmosis
    100932473 (RELA)
   05140 Leishmaniasis
    100932473 (RELA)
   05142 Chagas disease
    100932473 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100932473 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:shr03000]
    100932473 (RELA)
Transcription factors [BR:shr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    100932473 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 100932473
NCBI-ProteinID: XP_031799278
LinkDB
Position
6
AA seq 540 aa
MEDLLPMIFASDSPPARGPFVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKEPPHRPHPHELVGKDCRDGFYEADLCPDHCIHSFQNLGIQC
VKKRDLEQAIAHRMQTNNNPFNVPLEEQRGDYDLNAVRLCFQVTIRDAAGRPLVLPPVLS
HPIYDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVCFTGQGWEARGSFS
QADVHRQVAIVFRTPPYAEPALAAPVRVHMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTLGTFKNIMKTSPFTGNSDAWAPPRRIAVPSRSSTASAAKPPGVLPGLPASVSQPY
FPPSLSTINLEEFSPMVFGSGQVPAPALAPAPPTAPSLGPAPAPAAPAPALPQLPQSGEG
MLSDAMLGLQFDTDGDLTELLGDPDGTYANLAAIDNSEFQQLLNQGIAGSLEGPGPSGEP
MLMEYPESITRLMTGPQRPPEPGPAPSGPSGLANGLLGADEVFPSVGDMDLQAFLSQISS
NT seq 1623 nt   +upstreamnt  +downstreamnt
atggaggacttgttacccatgatcttcgcttcggattcgcccccggcccggggccccttc
gtggagatcatcgagcagcccaagcagcgggggatgcgcttccgctacaagtgcgagggc
cggtctgcgggcagcatccccggggagcgcagcacggacaccaccaagacgcaccccacc
atcaagatcaatggctacacaggaccgggaaccgtccgcatctcgctggtgaccaaggag
cccccccaccggcctcaccctcacgagctggtggggaaggactgcagggacggcttctat
gaggccgacctctgccctgaccactgcatccacagcttccagaacctggggattcagtgt
gtgaagaagcgagatctggagcaggccattgcccaccgcatgcagaccaacaacaacccc
ttcaatgtgcccctggaagagcagcgtggagattatgacctgaatgcagttcggctctgc
ttccaagtgaccatccgggacgctgcgggcaggcccctcgtgctgcccccggtcctctcc
catcccatctatgacaaccgggcccccaacaccgcggagctgaagatctgccgcgtgaac
cgaaactcgggcagctgtctgggaggggacgagatcttcctcctctgtgacaaggtgcag
aaagaggacatcgaggtgtgcttcacgggccagggctgggaggcgcgaggctccttctcg
caggccgacgtgcacaggcaggtggccatcgtgttccgcaccccgccgtacgcagaacct
gccctggcggcgcccgtgcgggtccacatgcagctccggcgcccgtccgaccgggagctc
agcgagcccatggagttccagtatctgccggacacagacgaccgccaccggattgaggag
aagcgcaagaggacgctgggcacctttaagaacatcatgaagacgagtcctttcaccggc
aactcagatgcctgggcacctcccaggcgcatcgcggtgccctcccgcagcagcacggcc
tctgccgcgaagcccccgggtgtcctccccggcctacccgcctctgtctcccagccctac
ttccccccgtccctcagtaccatcaacttggaggaattttctcccatggtctttggctcg
ggtcaggtcccggccccagccctggcccctgccccccccactgccccctccttgggcccg
gccccagccccggcggcccccgccccggccctgccccagctcccccagtccggggaggga
atgctgtccgatgccatgctgggcctgcagtttgataccgatggggacctgaccgagctc
ctgggagacccagacggcacctacgccaacctcgcggccatcgacaactccgagttccag
cagttgctgaaccaggggatcgcgggttcccttgaaggccctgggccctcaggggagccc
atgctgatggagtaccccgagtccatcacccgcctgatgacggggcctcagcgtccccct
gagcccggcccggccccttcggggccctcggggctggccaatggtctgctgggagcggat
gaagtcttcccctccgtgggggatatggacctacaggccttcctgagtcagatcagctcc
taa

DBGET integrated database retrieval system