KEGG   Sarcophilus harrisii (Tasmanian devil): 100918319
Entry
100918319         CDS       T02286                                 

Gene name
NCOA4
Definition
(RefSeq) nuclear receptor coactivator 4
  KO
K09289  nuclear receptor coactivator 4
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04216  Ferroptosis
shr05200  Pathways in cancer
shr05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    100918319 (NCOA4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100918319 (NCOA4)
  09162 Cancer: specific types
   05216 Thyroid cancer
    100918319 (NCOA4)
SSDB
Motif
Pfam: ARA70
Other DBs
NCBI-GeneID: 100918319
NCBI-ProteinID: XP_003755235
Ensembl: ENSSHAG00000007412
UniProt: G3VZF1
LinkDB
Position
2
AA seq 620 aa
MNISQDQSGSSSNKEPLARCCEARKELEHAIGGVLRAEQHIKDNLREVKAQIHSCISRHL
ECLRSREVWLYEQVDLIYQLKEETLQQQAQQLYWLLGQFNCLIHQLECTRSKDLANQVSV
CLERLGSLTLKPEDSTVLLFEADTASLRQTITTFGSLKTMQIPEHLMTCAASPNPGPPVE
RRASFPKQEQKPSSRPSFIPLRDWLLGSKPASTRQSPYVPSTNPQDWLNKKSALTSSQGS
SQTCNFNISNIWGNFKGLENWLHKQDVSEKRIPSKRKSSFSTASLQGPDLELPEQEEMDL
SDWLVTSPDPENGNFESDDKSKLFRLFKEDYNASDWLLKPGSCTNCQGNQPKGVEIENLG
NLKCLNEHLEGKKTAFSSLTPSENWLVQHHQVPFKVEEVCKANEPCTSFSECVCEDQCEK
EALCKWLLKKEGKDKNGVPMDQLPVLKSEPAKLKPSLNMWLCPSRDEAEEQAKTPKPAPC
TIPEPLKILLDSSLSDWLVKTKPKEIRVQEANSPDDKVPQEGLSPAKQMRPNPMTIWHCP
INAADWILPSKNTGSSSQPPGEDKWLLRKKAQEAFLNSPLREEHPFPQDHYGLPAVCDLF
ACMQLKVDKDKWLYRTPVQI
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgaatatatcacaggaccagagtggcagttccagcaataaagagcccctggccaggtgc
tgtgaagcccgtaaggaattggagcatgccattggtggtgttctcagggctgaacagcac
attaaagacaacttgagagaagttaaagctcagattcacagctgcataagccgtcaccta
gaatgtttgcgcagccgtgaggtgtggttgtatgaacaggtggatctcatctatcagctt
aaagaagaaacacttcagcagcaagctcagcagctctattggttactgggacaattcaat
tgtcttattcaccagttggaatgtacccgtagtaaggatctagccaatcaagtttctgtg
tgcttggagaggctgggtagcttgaccctcaaacctgaagattccactgtcctgctgttt
gaggctgatacagcttctctgcgtcagaccatcactacatttggctctctcaaaaccatg
caaattcccgagcacttgatgacttgtgctgcttcacccaatcctgggccacctgtagag
agaagggcttcttttcccaagcaggagcagaaaccatcatctcgtccttcatttattcca
cttcgtgactggctccttggaagcaaacctgcctcaactcgtcagtctccttatgtacct
agtaccaaccctcaagattggcttaacaaaaagtcagctttgacaagcagccagggttcc
tcccaaacctgcaactttaatatcagtaacatctggggcaacttcaagggcttggaaaat
tggctccacaagcaagatgtttctgagaaaagaattccctcaaagcgtaaaagctccttc
tctacggcctctctacaggggcctgacctagagctccctgagcaagaagaaatggatctt
tctgattggctggttacctctcctgaccctgagaatggtaactttgaatcagatgataag
tcaaagctttttcgacttttcaaggaagattataatgcaagtgattggcttctcaagcct
ggttcctgcaccaactgtcagggcaaccagcccaaaggtgtagagattgaaaatttggga
aatctgaagtgcctgaatgagcacctggaagggaagaagacagcattttcctccctcaca
ccaagtgagaattggcttgttcagcatcatcaggttccttttaaagttgaggaggtgtgc
aaagctaatgagccttgtactagcttttccgagtgtgtttgtgaagaccaatgtgagaag
gaggccttgtgtaagtggctcctgaaaaaggaaggaaaggataaaaatggtgtcccaatg
gatcaactgccagttttgaaatctgagccagcaaagctgaaaccctccttgaatatgtgg
ctttgtccctctagggatgaggcagaggaacaggctaagacaccaaagccagctccttgt
acaattcctgaacccctcaagatcttgctggacagctccttgtcagattggcttgtcaaa
acaaaacccaaagaaataagagtacaggaagcaaacagtccggatgacaaagttccccag
gagggcctgtcaccagccaaacaaatgcgacctaaccccatgaccatttggcactgtcca
attaatgcagctgattggatattgccttcaaagaacacaggaagctctagccagccccct
ggggaagacaagtggttacttcgaaagaaggcccaggaagcattcctcaattcaccccta
cgagaagaacatccctttccccaagaccattatggcctgccagcagtttgtgatcttttt
gcctgtatgcagcttaaagtcgacaaagacaagtggttgtaccgaacccctgtccagata
tga

KEGG   Sarcophilus harrisii (Tasmanian devil): 100926427
Entry
100926427         CDS       T02286                                 

Gene name
CCDC6
Definition
(RefSeq) LOW QUALITY PROTEIN: coiled-coil domain-containing protein 6
  KO
K09288  coiled-coil domain-containing protein 6
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr05200  Pathways in cancer
shr05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100926427 (CCDC6)
  09162 Cancer: specific types
   05216 Thyroid cancer
    100926427 (CCDC6)
SSDB
Motif
Pfam: DUF2046
Other DBs
NCBI-GeneID: 100926427
NCBI-ProteinID: XP_031805244
LinkDB
Position
2
AA seq 640 aa
MRTRDTQRVAHTARPRTLYRTGSGHGSAPDFRAGSGFWWMPSGRAASRPLSLQQGDQRLG
HSERLVNAPRWLCFVPSAVHTDFAHVDYSAIHRSRGAAAARARPRRSRAPRAPLRSFSSA
AAAAAAPRACAGPGPAPRSRGASRSSPLPGPRRACAGHGADSASESDTDGGRPGGGGPAG
XGGGGGVAVVLPGAGGGGGGAGGGPGPGGGGKPGGIVISPFRLEELTNRLASLQQENKVL
KIELETYKLKCKALQEENRDLRKASVTIQARAEQEEEFISNTLFKKIQALQKEKETLAVN
YEKEEEFLTNELSRKLMQLQHEKAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLE
QLRREKIDLENTLEQEQEALVNRLWKRMDKLEAEKRILQEKLDQPVSAPPSPRDISMEID
SPENMMRHIRFLKNEVERLKKQLRAAQLQHSEKMAQYLEEERHMREENLRLQRKLQREME
RREALCRQLSESESSLEMDDERYFNEMSAQGLRPRTVSSPIPYTPSPSSSRPISPGLSYT
SHTVGFTPPTSLTRAGMSYYNSPGLHVQHMGASHGITRPSPRRSNSPDKFKRPTPPPSPN
TQTPVQPPPPPPPPPMQASLPSATSPPASSPHPVHPPPQP
NT seq 1923 nt   +upstreamnt  +downstreamnt
atgcgcacccgggacacacagcgtgtggcgcacactgcacgcccacgcaccctgtaccgg
acgggatcagggcatgggtcggcccctgatttccgggccggatcgggcttctggtggatg
cccagtggtcgggctgcctcgcggcctttgtccctgcaacaaggggaccagcggctggga
cacagtgagcgcttagtaaatgctccccgctggctttgctttgtacctagtgcagtccat
acagactttgcccacgtcgattacagtgcaattcacaggagccgaggtgcagcggccgcc
cgggctcggccccgccggtcccgggccccgcgcgctccgctccgctctttctcctcggcc
gccgccgccgccgccgcgccgcgagcgtgcgccggccccggccctgcgccccgctcccgc
ggcgcctctcgtagctcgccgctccctggtccccgccgcgcctgcgcgggccatggcgcc
gacagcgccagcgagagcgacacggacggcgggcggcccgggggcggcgggccggcgggc
nncgggggcggcggcggcgtggcagtcgtgctcccgggcgcgggcggcggcggcggcggc
gcgggcggcgggcccgggcccggcggcggcgggaagccgggcggcattgtcatctcgccg
ttccgcctggaggagctcaccaaccggctggcgtcgctgcagcaggagaacaaggtgctc
aagatcgagctggagacgtacaagctcaagtgcaaggcgctgcaggaggagaaccgggac
ctgcgcaaggccagcgtcaccatccaagccagggctgagcaagaggaggagttcatcagc
aacaccttgttcaagaagattcaggccttgcagaaggagaaggagactctcgccgtgaat
tacgagaaggaagaggagttcctcaccaatgagctgtccaggaaactgatgcagctgcag
cacgagaaggcagagctggagcagcacctggagcaggagcaggagttccaggtcaataaa
ctgatgaagaaaatcaagaagctggagaacgacaccatctcgaagcagctcacgctggag
cagctgcggcgggagaagattgacctcgaaaatacattggagcaagagcaggaggcgctg
gtcaatcgtctctggaagaggatggacaagctggaggctgagaaacgaatcttgcaggag
aaattggaccagcccgtctcggctcccccgtcgccccgggacatctccatggagatcgac
tctccagaaaacatgatgcggcacatccggtttttaaagaatgaagtggagagactgaag
aagcagctgcgagctgcccagctacagcactcggagaagatggcccagtatttggaggag
gagcgccacatgcgggaagagaacctgcgcctgcagaggaagctccagcgcgagatggag
cggagggaggccctctgccggcagctctcagagagcgagtccagcttggagatggacgac
gaaaggtattttaacgagatgtctgcccaaggcttacgacctcgcactgtgtccagcccg
atcccttacacgccttctcccagttccagcaggcccatctcaccgggtctgtcgtacaca
agtcacacagttggcttcacgcccccgacgtcgctgacccgagccggaatgtcttactac
aactcccccggactccatgtgcagcacatgggagcctcccacgggatcacaaggccttca
ccccggagaagcaacagtccggacaaatttaagcgccccacgcctccgccatctccgaac
acacagactcccgtccagcctcctccgcctccgcccccaccccccatgcaggcctccctc
ccgtccgccacctcgccgcccgcctcctcaccacatccggtgcatccccccccacagccc
tag

KEGG   Sarcophilus harrisii (Tasmanian devil): 100927200
Entry
100927200         CDS       T02286                                 

Gene name
RET
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase receptor Ret
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr05200  Pathways in cancer
shr05216  Thyroid cancer
shr05223  Non-small cell lung cancer
shr05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100927200 (RET)
   05230 Central carbon metabolism in cancer
    100927200 (RET)
  09162 Cancer: specific types
   05216 Thyroid cancer
    100927200 (RET)
   05223 Non-small cell lung cancer
    100927200 (RET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100927200 (RET)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100927200 (RET)
Protein kinases [BR:shr01001]
 Receptor tyrosine kinases (RTK)
  RET family
   100927200 (RET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr RET_CLD1 RET_CLD3 RET_CLD4 Pkinase Cadherin RIO1 Pkinase_fungal Cadherin_pro
Other DBs
NCBI-GeneID: 100927200
NCBI-ProteinID: XP_031812239
LinkDB
Position
2
AA seq 1105 aa
MSLRGGLVGLLLLCEAVLGLYFSRDTYSEKLYIDEPVGTPLLYVHALQDARGEVPHFRLG
QHLYSTYRSQPHKNDWFQINEDTGLLYLNQSLDQRALEKLSARNGGFPLLTIYLQVFLSP
KPLRESDCHWPSCAKVMLSVINTTMPACSSLKPREFCFLETGLSFRIRENKPPGTFHQFR
LLPVQHLCPNISISYQLLGEEALPFYSDKDTMEVNMRHSLDREEKEKYELIAKCTVWEGL
REEVVMVPFPVTVYDEDDSPPNFPNGINTANAVVEYKRKEGTVLAVLQVFDADVVPSSVD
IPRKYIHTMLTSDPLVNEFFRVEHSPNETSYNSNGSRVRAMMHDYKLVLNRSLPITESHS
FQLGVLVNDTDYQGPGGVLHLYFNVTILPVSIRFPNISYSFSVNRNAHRYAQIGKVCIEN
CKEFHGVNITYKLQSLSVNCTALGIITTPESTTGNLFVNDTSMLQRPECTGMKYLVIASD
RQSKKQSRTTSTISVEGNFFPEEEGCPISCAVNKRRSECEECGGLGTLMGTCQWRQGDGK
GISKNYSTCTPSLKTCPDGNCDAVESRDLHICPQDCIRGDIIGGHERGEWRGIKAGYGVC
NCFPEKKKCFCEPDDDKEPLCDEVCRMVIAVAVLFSFIFSVLLSSYFIRRYHKNSHKPPI
ASAEMTFRRPAQAYPISYSSSNVRRPSLDSMENQVSVDAFKIPEDPKWEFPRKNLVLGKT
LGEGEFGKVVKATAFRLKGKAGYTTVAVKMLKENASPSELKDLLSEFNLLKQVNHPHVIK
LYGACSQDGPLYLIVEYAKYGSLRSFLRESRKVGPSYMGGNGNRNSSYLDNPDERALTMG
DLISFAWQISRGMHYLAEMKLVHRDLAARNVLVAEGRKMKISDFGLSRDVYEEDSYVKRS
KGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLFNLLKTGYR
MERPENCSEEMYNLMLHCWKQEPDKRPTFGEISKDLEKMMVKSRDYLDLAASTPSDSLLY
DDGLSEEETPLVDCNNAPLPRTLPSTWIENKLYGMSYPNWPEESPVPLTRFDGTNSVFSR
YANDSVYANWMVSPSAAKLMDKFNS
NT seq 3318 nt   +upstreamnt  +downstreamnt
atgtctcttcgcggggggctcgtggggcttctccttctttgtgaagctgtgttgggtctt
tatttttctcgggacacttactcagaaaaactatacattgacgaacctgttggaacaccc
ctgctctatgttcatgccttacaagatgccagaggggaggtgccacacttccgcctgggc
cagcatctctatagtacctatcggtctcagccgcacaagaatgactggttccagatcaat
gaagatacaggccttctctacctcaaccaaagtctggaccaaagggccttggagaaactg
agtgcccgaaatggaggatttcccctactcaccatctaccttcaagtattcctctcacca
aagccattacgggagagtgattgccattggcccagctgtgccaaagtgatgctgtctgtc
atcaataccaccatgccagcctgcagttctctgaagcctagggaattctgctttttggag
acagggctctcatttcgcatcagggagaataagccaccgggtactttccaccaattccgt
ttacttcctgtgcagcatctgtgtccaaatatcagcatttcctaccaattgcttggagaa
gaagcccttcccttctattctgataaggacaccatggaggtgaacatgaggcactcactg
gaccgggaagaaaaggagaagtatgaattgattgccaagtgcacagtttgggaaggtttg
cgagaagaggttgtgatggtgccctttcctgtgactgtatatgatgaagatgattcacct
cctaatttccccaatggcatcaacacagctaatgcagttgtggagtacaaacggaaagag
ggtacagtattggctgtcctgcaggttttcgatgcagatgtcgtgccttcctctgtggac
atcccaagaaagtacatacataccatgctgaccagtgaccctttggtcaatgagttcttc
cgggtggaacactcaccaaatgaaacttcatacaactctaatggaagtcgtgtgcgggcg
atgatgcatgattacaaactggtgctcaaccgaagccttcctatcacagagagccattct
ttccagctgggagtcctggtgaatgacactgactaccagggtcctggaggagtactccat
ctctatttcaatgtgaccatcctgcctgtcagcatacggtttccaaacatctcctattcc
ttctcagtaaatcggaatgctcaccgatatgcacagattggaaaagtttgcattgaaaac
tgcaaggagttccatggagtaaatattacctacaaactacagtcactcagtgttaattgc
accgctctgggcatcatcaccaccccagaaagcacaacagggaatctgtttgtgaatgac
acctctatgctgcagagaccggaatgcacaggaatgaaatatttggtaattgcatcagac
agacagagcaagaaacaatccagaacaacatctactatctcagtagaaggaaattttttc
cctgaggaggagggctgtcccatttcatgtgcagtgaacaagagacgttcagaatgtgaa
gaatgtggtggcttgggcaccctgatgggcacatgccagtggagacaaggagatggcaaa
ggaatttccaagaactattcgacttgcactccaagcctcaagacttgtcctgatggcaac
tgtgatgcagtagaaagtcgagatcttcatatctgccctcaagattgcatacggggagac
attattggtggtcatgagagaggagaatggaggggaatcaaggctggatatggagtctgc
aactgctttccagaaaaaaagaagtgtttctgtgagccggatgatgataaagaaccgctt
tgtgatgaagtctgcagaatggtcattgccgtagccgtacttttctccttcatcttctct
gtgctgctctcttcctacttcatccgtcgctaccacaagaactcccacaagccacccatt
gcctctgcagagatgaccttcaggaggcctgctcaggcttaccccatcagctattcttcc
tccaatgttcgccggccatctttggattccatggagaaccaggtctcagtggatgccttc
aaaatccctgaggatccaaagtgggaatttcctcggaagaatttagttcttggaaaaacc
ctaggagaaggagagtttggaaaggtcgtcaaggcaacagctttccgactcaaagggaaa
gcaggctacaccactgtggcagtgaaaatgctgaaagaaaatgcttctccaagtgagctc
aaagacctgctgtcagagtttaacctgctaaaacaggtcaaccacccccacgtcattaaa
ctctatggcgcctgcagtcaggatggacctctctacttgattgtggagtatgctaagtat
ggttctctgcggagcttcctccgggaaagccggaaggtgggacccagctacatgggaggt
aatggcaatcggaattctagctacttggacaatccggatgagagggcactgaccatggga
gatctcatttccttcgcctggcagatttcccgaggaatgcattatcttgcagaaatgaag
ctggtccaccgtgatttagcagctaggaatgtcttggtggctgaaggacgcaaaatgaag
atttctgattttggcctttcccgagatgtttatgaagaggactcctatgtcaaaaggagc
aagggccggattcctgtaaagtggatggcaattgagtctctttttgatcatatctacact
acccaaagtgatgtgtggtcatttggtgtgttgctctgggaaattgtaaccctaggagga
aatccctatcctggtattcctcctgaacgtctcttcaaccttctaaaaacgggctatcga
atggagaggcctgaaaactgcagtgaagaaatgtacaatctgatgttgcactgctggaag
caggaaccagataagaggccaacatttggggagatcagcaaagacctagagaagatgatg
gtgaagagtagggactacttggatcttgcagcttctaccccatctgactccttactttat
gatgatggcctttcagaagaggagactcccctcgtggactgtaataatgctcccctccct
cgaaccctcccttccacatggattgaaaacaaactctatggcatgtcatacccgaactgg
cctgaggagagtcctgtcccactcacaagattcgatggcactaactctgtgttttcaaga
tatgcaaatgatagtgtatatgctaactggatggtttcaccctcagcggcaaaattaatg
gacaagtttaatagttaa

DBGET integrated database retrieval system