KEGG   Sarcophilus harrisii (Tasmanian devil): 100919874
Entry
100919874         CDS       T02286                                 

Gene name
MDM2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2 isoform X1
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01522  Endocrine resistance
shr01524  Platinum drug resistance
shr04068  FoxO signaling pathway
shr04110  Cell cycle
shr04115  p53 signaling pathway
shr04120  Ubiquitin mediated proteolysis
shr04144  Endocytosis
shr04151  PI3K-Akt signaling pathway
shr04218  Cellular senescence
shr04625  C-type lectin receptor signaling pathway
shr04919  Thyroid hormone signaling pathway
shr05163  Human cytomegalovirus infection
shr05165  Human papillomavirus infection
shr05169  Epstein-Barr virus infection
shr05200  Pathways in cancer
shr05202  Transcriptional misregulation in cancer
shr05203  Viral carcinogenesis
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05218  Melanoma
shr05219  Bladder cancer
shr05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:shr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100919874 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100919874 (MDM2)
   04151 PI3K-Akt signaling pathway
    100919874 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100919874 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    100919874 (MDM2)
   04115 p53 signaling pathway
    100919874 (MDM2)
   04218 Cellular senescence
    100919874 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100919874 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100919874 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100919874 (MDM2)
   05202 Transcriptional misregulation in cancer
    100919874 (MDM2)
   05206 MicroRNAs in cancer
    100919874 (MDM2)
   05205 Proteoglycans in cancer
    100919874 (MDM2)
   05203 Viral carcinogenesis
    100919874 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    100919874 (MDM2)
   05220 Chronic myeloid leukemia
    100919874 (MDM2)
   05218 Melanoma
    100919874 (MDM2)
   05219 Bladder cancer
    100919874 (MDM2)
   05215 Prostate cancer
    100919874 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100919874 (MDM2)
   05169 Epstein-Barr virus infection
    100919874 (MDM2)
   05165 Human papillomavirus infection
    100919874 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100919874 (MDM2)
   01522 Endocrine resistance
    100919874 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:shr04131]
    100919874 (MDM2)
   04121 Ubiquitin system [BR:shr04121]
    100919874 (MDM2)
Enzymes [BR:shr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100919874 (MDM2)
Membrane trafficking [BR:shr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    100919874 (MDM2)
Ubiquitin system [BR:shr04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    100919874 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS DZR
Other DBs
NCBI-GeneID: 100919874
NCBI-ProteinID: XP_031796589
Ensembl: ENSSHAG00000010284
LinkDB
Position
5
AA seq 482 aa
MCNTKMSSDTEGALSTSQIPASEQEALVRPKPLLLKLLKFAGAQKDTFTMKEVLFYLGQY
IMSKQLYDKKQQHIVYCSDDLLGDLFGVPSFSVKEHRRLYAMISRNLIAVNQQEFSSPNT
SSNETRCQLEIRSGQKESMQELQEEKPSPNFNSRPTTSSRRRTHSETENSDELPGERHRK
RHKSDSISLTFDESCALCVISEICCERSNSSDSTEIPSSPDIDTGVLSENSDDSVSDQFS
VEFEVESIDSEDYSHNEEGQELTDDDDEIYQVTVYQAEESDTDSFDEDPEISLADYWKCT
SCDKMNPPLPPHCHRCWALRENWLPEEKGEVVNKGKLESPIQGEEEGFDVPDCKKNKMND
SQDSCIEESDEKIVQTSDSQESEDYSQPSTSKSIICSSQEDNGEFEREEAQDKEKNMESL
LPPSTVEPCVICQSRPKNGCIVHGRTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLTY
FL
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgtgcaataccaaaatgtcttctgacacagaaggtgccttaagcacctcacaaattcca
gcttcggaacaagaggctctggttcgaccaaaaccattgctcttgaagttgttgaagttt
gctggtgcgcagaaagacacattcacaatgaaggaggttttattctatcttggccagtat
attatgtcaaaacagttatatgacaaaaagcagcagcacattgtttattgttcagatgac
cttcttggagatctatttggggtaccaagcttctctgtgaaagaacataggagattatat
gcaatgatatctagaaacttgatagcagtcaatcaacaggaattttctagtccaaacaca
tcttcaaatgaaaccaggtgtcagcttgaaatcagaagtggtcaaaaggaatctatgcaa
gagttacaggaagagaaaccatcaccaaattttaattctagaccaactacctcatccaga
aggagaacacatagtgaaacagaaaattcggatgaattgcctggtgaaagacacagaaaa
cggcataagtcagatagtatttcccttacatttgatgaaagctgtgctctgtgtgtcata
agtgaaatatgctgtgaacgaagcaatagcagtgactcaacagaaatcccttcaagtccg
gatattgatactggtgtattaagtgaaaattcagatgattcagtttcagaccaattcagt
gttgagtttgaagttgagtctattgattcagaagattatagtcacaatgaagaaggacaa
gaactcacagatgacgatgatgagatataccaggtaaccgtatatcaggcagaggaaagt
gacacagactcatttgatgaagaccctgaaatatccttagccgattattggaagtgtact
tcatgtgataaaatgaaccctccacttcctccacattgccacagatgttgggctttgcga
gaaaattggcttcctgaggagaaaggtgaagttgtgaataaaggcaaactagaaagtccc
atacaaggggaagaagagggctttgatgttccagattgtaagaaaaataaaatgaatgac
tctcaagattcatgtattgaggaaagtgatgaaaagatagtacagacatcagactctcaa
gaaagtgaggattattcccagccatcaacatctaaaagtatcatttgtagtagtcaggaa
gataatggagaatttgagagagaagaagcacaagataaagaaaaaaatatggaatctctt
ctaccccctagcacagtagagccctgtgtcatctgtcagagccgacctaaaaatggttgc
attgtccatggaaggacaggacatcttatggcatgttttacatgtgctaagaaattgaaa
aagagaaataagccttgtccagtgtgcaggcagccaattcaaatgattgtgttaacttat
tttctctaa

KEGG   Sarcophilus harrisii (Tasmanian devil): 100920321
Entry
100920321         CDS       T02286                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2-like isoform X1
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01522  Endocrine resistance
shr01524  Platinum drug resistance
shr04068  FoxO signaling pathway
shr04110  Cell cycle
shr04115  p53 signaling pathway
shr04120  Ubiquitin mediated proteolysis
shr04144  Endocytosis
shr04151  PI3K-Akt signaling pathway
shr04218  Cellular senescence
shr04625  C-type lectin receptor signaling pathway
shr04919  Thyroid hormone signaling pathway
shr05163  Human cytomegalovirus infection
shr05165  Human papillomavirus infection
shr05169  Epstein-Barr virus infection
shr05200  Pathways in cancer
shr05202  Transcriptional misregulation in cancer
shr05203  Viral carcinogenesis
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05218  Melanoma
shr05219  Bladder cancer
shr05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:shr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100920321
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100920321
   04151 PI3K-Akt signaling pathway
    100920321
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100920321
  09143 Cell growth and death
   04110 Cell cycle
    100920321
   04115 p53 signaling pathway
    100920321
   04218 Cellular senescence
    100920321
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100920321
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100920321
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100920321
   05202 Transcriptional misregulation in cancer
    100920321
   05206 MicroRNAs in cancer
    100920321
   05205 Proteoglycans in cancer
    100920321
   05203 Viral carcinogenesis
    100920321
  09162 Cancer: specific types
   05214 Glioma
    100920321
   05220 Chronic myeloid leukemia
    100920321
   05218 Melanoma
    100920321
   05219 Bladder cancer
    100920321
   05215 Prostate cancer
    100920321
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100920321
   05169 Epstein-Barr virus infection
    100920321
   05165 Human papillomavirus infection
    100920321
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100920321
   01522 Endocrine resistance
    100920321
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:shr04131]
    100920321
   04121 Ubiquitin system [BR:shr04121]
    100920321
Enzymes [BR:shr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100920321
Membrane trafficking [BR:shr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    100920321
Ubiquitin system [BR:shr04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    100920321
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS
Other DBs
NCBI-GeneID: 100920321
NCBI-ProteinID: XP_031794016
LinkDB
Position
5
AA seq 626 aa
MSSDTDGTFSASQIPASEQEALVRPKPLFLKLLKLAGAQKDAFTMKEVLFYLGQYIMSKQ
LYDKKQQHIVYCSDDLLGDLFGVPSFSVKEPRKLYAMISRNLTAVNQQEFASANTSTNET
RHLPEIGSDEEASMQELQEEKPPNLNATPTTSFRRTHSETEFTSRNTSTNEIGHRLEIGS
DQEESMQEERPPNLNATPTTSPRRMHSEIEFAGPNASTNETRNLLEIGSDQEASMQELQE
EKPPNLNATLTTSPRKTHSETEFASPNTSSNETRRRLEIGSEKEESMQQLQEERPPNLNS
RPTTSSRRTHSEIENSDELPGERDRKRHKSDSMSLTFDESCALCVLREICCEQNITSDST
EIPSSPDIDTGILNEDSGDSVSDQFSVEFEVESNDSEDYSHNEEGQELSDEDDEICQIYQ
VEESDTDSFDEDLEISLVDYWKCPSCDKINPPLPPHCHRCWTARENWLSEEKGEVLEKGT
IENPTQGEEEGFDVPDCKKNKINDSQDSCVEESDEKVVQTSDSQESEDYSQPSTSKSIMC
SSQEDAGEFERKEAQDKEKNMGCFLPLSTVEPCVICQSRPKNGCIVHGRTGHLMACFTCA
KKLKKRNKPCPVCRQPIQMIVLTYFL
NT seq 1881 nt   +upstreamnt  +downstreamnt
atgtcttctgacactgacggtaccttcagcgcctcacagattccagcttcggaacaagag
gctctggttcgaccaaaaccattgttcttgaagttattgaagttagctggtgcacagaaa
gacgcatttacaatgaaagaggttttattctatcttggccagtatattatgtcaaaacag
ttatatgacaaaaagcaacagcacattgtttattgttcagatgatcttcttggagatctg
tttggggtaccaagcttctctgtgaaagaacctaggaaattatatgcaatgatatctaga
aacttgacagcagtgaatcaacaggaatttgctagcgcaaacacatctacaaatgaaacc
aggcatctccctgaaattggaagtgatgaagaggcatctatgcaagaattgcaagaagag
aaaccaccgaatttgaatgctacaccgactacctcattcagaagaacacatagtgaaaca
gaatttactagccgaaacacatctacaaatgaaatcgggcatcgccttgaaattggaagt
gatcaagaggaatctatgcaagaagagagaccgccaaatttgaatgctaccccaactacc
tcacccagaagaatgcatagtgaaatagaatttgctggcccaaacgcatctacaaatgaa
accaggaatctccttgaaattggaagtgatcaagaggcatctatgcaagaattgcaagaa
gagaaaccaccgaatttgaatgctacactgactacctcacccagaaaaacacatagtgaa
acagaatttgctagcccaaacacatcttcaaatgaaaccaggcgtcgccttgaaattgga
agtgaaaaagaggaatctatgcaacaattgcaagaagagagaccaccaaatttgaattct
agaccaactacctcatccagaagaacacatagtgaaatagaaaattcggatgaactgcct
ggtgaaagagacagaaaacggcataagtcagatagtatgtcccttacatttgatgaaagc
tgtgctctatgtgtcttaagagagatatgctgtgaacaaaacattaccagtgactcaaca
gaaatcccttcaagtccggatattgatactggtatattaaatgaagattcaggagattca
gtttcagaccaatttagtgttgagtttgaagttgaatctaatgattcagaagattatagt
cacaatgaagaaggacaagaactctcagatgaagatgatgagatatgccagatctatcag
gtagaggaaagtgataccgactcattcgatgaagaccttgaaatatccttagtcgattat
tggaagtgtccttcctgtgacaaaataaaccctccacttccaccacattgccacagatgt
tggactgcccgagaaaattggctttctgaggagaaaggtgaagttttggagaaaggcaca
atagaaaatcccacacaaggggaagaagagggctttgatgttccagattgtaagaaaaat
aaaatcaatgactctcaagattcatgtgttgaggaaagtgatgaaaaggtagtacagaca
tcagactcccaagagagtgaggattattcccagccatcaacatctaaaagtatcatgtgt
agtagtcaagaagatgctggagaatttgagagaaaagaagcacaagacaaagaaaaaaat
atgggatgttttcttccccttagcacagtagagccctgtgtcatctgtcagagccgacct
aaaaatggttgcattgtccatggaaggacaggacatcttatggcgtgttttacatgtgct
aagaaattgaaaaagagaaataagccttgtccagtgtgcaggcagccaattcaaatgatt
gtgttaacttattttctctaa

DBGET integrated database retrieval system