KEGG   Sarcophilus harrisii (Tasmanian devil): 100921594
Entry
100921594         CDS       T02286                                 

Gene name
E2F2
Definition
(RefSeq) transcription factor E2F2
  KO
K09389  transcription factor E2F2
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01522  Endocrine resistance
shr04110  Cell cycle
shr04218  Cellular senescence
shr04934  Cushing syndrome
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05163  Human cytomegalovirus infection
shr05166  Human T-cell leukemia virus 1 infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05169  Epstein-Barr virus infection
shr05200  Pathways in cancer
shr05206  MicroRNAs in cancer
shr05212  Pancreatic cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05218  Melanoma
shr05219  Bladder cancer
shr05220  Chronic myeloid leukemia
shr05222  Small cell lung cancer
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100921594 (E2F2)
   04218 Cellular senescence
    100921594 (E2F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100921594 (E2F2)
   05206 MicroRNAs in cancer
    100921594 (E2F2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100921594 (E2F2)
   05225 Hepatocellular carcinoma
    100921594 (E2F2)
   05226 Gastric cancer
    100921594 (E2F2)
   05214 Glioma
    100921594 (E2F2)
   05220 Chronic myeloid leukemia
    100921594 (E2F2)
   05218 Melanoma
    100921594 (E2F2)
   05219 Bladder cancer
    100921594 (E2F2)
   05215 Prostate cancer
    100921594 (E2F2)
   05224 Breast cancer
    100921594 (E2F2)
   05222 Small cell lung cancer
    100921594 (E2F2)
   05223 Non-small cell lung cancer
    100921594 (E2F2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100921594 (E2F2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100921594 (E2F2)
   05161 Hepatitis B
    100921594 (E2F2)
   05160 Hepatitis C
    100921594 (E2F2)
   05163 Human cytomegalovirus infection
    100921594 (E2F2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100921594 (E2F2)
   05169 Epstein-Barr virus infection
    100921594 (E2F2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100921594 (E2F2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:shr03000]
    100921594 (E2F2)
Transcription factors [BR:shr03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    100921594 (E2F2)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 100921594
NCBI-ProteinID: XP_031818481
LinkDB
Position
3
AA seq 592 aa
MYPFRWVEPVPVVLTNPRALFSAGDPNFAARSLALKKKKGGKKRSPGHRENGGRAGASGA
RSGTIWASPGGDGLAAPEAPGRGPDAGHPLCRAAWRRRRGPLLPSPPSRGLPLPPARTRA
GHAHPVLAPAGLPGPASRSLLPYPNGSGSSSAGPMLRIPKGVSPAPGGSALAGPQKPPQP
LQIKKALPVVSPVWAADVRSPPGGPVPASHFTQLYPPVVAAAAPGSCLDATPQGPEIRAG
RASAGRLPGFKAKRKLDLEGMGRQGLSEFRTPKGKCGGGEGLPSPKTPKSPGEKTRYDTS
LGLLTKKFIYLLSESEDGVLDLNWAAEVLEVQKRRIYDITNVLEGIQLIRKKAKNNIQWV
GRGMFEDPAGAGKQQTLGQELKELSNTERTLDQLIQNCTLDLKNLTEDETNQRLAYVTYQ
DIRAIGNFKDQTVIVVKAPPETRLEVPDLREENLQIYLKSTNGPIEVYLCPEENLEASIP
SQEAPPCGSGPFTGLPGSPGSSGGLDFIVPPAVALKSQPSQALLEVNEGLLDLPHPLLQQ
TEDQLLSSSLSGSPLVNFSPPLDEEDYLWGLDSGEGVSDLFESYDLGDLLRN
NT seq 1779 nt   +upstreamnt  +downstreamnt
atgtatcctttccggtgggtggagcctgtgcctgttgttctgaccaatccgagggcgtta
ttttccgcgggagatccgaatttcgcggcacgcagtttggcgctaaaaaaaaaaaaagga
ggaaaaaaaaggagtccgggacacagagagaacggagggagggctggggcaagtggagcg
cggtcggggaccatctgggcctctcccggcggagacggcctcgcagcccccgaggcaccc
ggcaggggtccggacgccggccatcccctctgccgggctgcctggaggaggcggcgcggg
cccctcctaccctccccgccctctcggggcttgccgctgccaccggctcggacccgggcc
ggccatgcccatcccgtcctagcccccgccgggctccctggcccagcctcgcgctctctc
ctcccgtatcccaacggctccggatcgtcttccgcaggcccgatgctgaggatccccaag
ggggtctccccggccccggggggctccgccctggccgggccgcagaaacctccccagccg
ctgcagatcaagaaggccctgccggtggtgagcccggtgtgggcggccgacgtgcgcagc
cccccggggggcccggtcccggccagccacttcactcagctgtaccccccggtggtggcc
gccgccgccccgggcagctgcctggacgccaccccgcaggggcccgagatccgcgccggg
cgcgcctccgccggccggctgccgggtttcaaggccaagaggaaattggatctggaggga
atgggacggcaggggctctctgaattccggacacccaaggggaagtgcggcggcggcgaa
ggcctcccaagtcccaagacccccaaatcgccaggtgagaaaactaggtatgacacgtct
ctgggcctgctcaccaagaagttcatttacctgctgagtgagtcagaggatggagtcttg
gacctgaactgggccgccgaggttctggaagtccaaaaacggcgcatctacgacatcacc
aacgtgctggaggggatccagctcatacggaagaaagccaagaacaacatccaatgggta
ggcaggggaatgtttgaagaccccgctggggccgggaagcagcagaccctggggcaagag
ctgaaggaactgagcaacaccgaaaggaccttggaccaactgattcagaactgcaccttg
gacctgaagaacctgacagaagatgagaccaaccagagattggcctatgtaacctaccag
gacattcgagctatagggaacttcaaggaccagacggtgattgtggtcaaagcccctccc
gagactcgcctagaagtcccagacctgagggaggagaacttgcagatttatctgaagagc
accaacggacccattgaggtgtacctgtgtccagaagaaaatctagaggccagcatcccc
tcccaggaggctcctccctgtggctcaggtccgttcactggcctgcccggcagccctggc
agctctggtggcctggatttcattgtacccccagctgtggctctgaagtcccagccgtcc
caggccctgctggaggtgaacgagggcctcctggacctgcctcacccactcctgcagcag
actgaggaccagctcctgtcctcgtccctgagcggctcgcctctggtcaacttctcccca
cccctggatgaggaggactacctgtggggcctggatagcggggagggcgtcagcgacctc
tttgagtcctacgacctcggggatctcctgaggaactaa

KEGG   Sarcophilus harrisii (Tasmanian devil): 100934669
Entry
100934669         CDS       T02286                                 

Gene name
E2F3
Definition
(RefSeq) transcription factor E2F3 isoform X1
  KO
K06620  transcription factor E2F3
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01522  Endocrine resistance
shr04110  Cell cycle
shr04218  Cellular senescence
shr04934  Cushing syndrome
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05163  Human cytomegalovirus infection
shr05166  Human T-cell leukemia virus 1 infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05169  Epstein-Barr virus infection
shr05200  Pathways in cancer
shr05206  MicroRNAs in cancer
shr05212  Pancreatic cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05218  Melanoma
shr05219  Bladder cancer
shr05220  Chronic myeloid leukemia
shr05222  Small cell lung cancer
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100934669 (E2F3)
   04218 Cellular senescence
    100934669 (E2F3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100934669 (E2F3)
   05206 MicroRNAs in cancer
    100934669 (E2F3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100934669 (E2F3)
   05225 Hepatocellular carcinoma
    100934669 (E2F3)
   05226 Gastric cancer
    100934669 (E2F3)
   05214 Glioma
    100934669 (E2F3)
   05220 Chronic myeloid leukemia
    100934669 (E2F3)
   05218 Melanoma
    100934669 (E2F3)
   05219 Bladder cancer
    100934669 (E2F3)
   05215 Prostate cancer
    100934669 (E2F3)
   05224 Breast cancer
    100934669 (E2F3)
   05222 Small cell lung cancer
    100934669 (E2F3)
   05223 Non-small cell lung cancer
    100934669 (E2F3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100934669 (E2F3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100934669 (E2F3)
   05161 Hepatitis B
    100934669 (E2F3)
   05160 Hepatitis C
    100934669 (E2F3)
   05163 Human cytomegalovirus infection
    100934669 (E2F3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100934669 (E2F3)
   05169 Epstein-Barr virus infection
    100934669 (E2F3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100934669 (E2F3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:shr03000]
    100934669 (E2F3)
Transcription factors [BR:shr03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    100934669 (E2F3)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 100934669
NCBI-ProteinID: XP_031802648
Ensembl: ENSSHAG00000015705
LinkDB
Position
1
AA seq 462 aa
MRKGIQPALEQFLVTAGGGEGAAAVAAAAAAAAASMDKRALLASPGFPATAAPGTYIQIL
TTNTTTSSSCSSSLQSGGATTGPQHTNIPGVEQTASSFLYSTPHGPSSRAGLLQQQPALG
RGGGGGPPAKRRLELGESGHQFLSDGLKTPKGKGRAAVRSPDSPKTPKSPSEKTRYDTSL
GLLTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQWMG
CSLSDDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDAENQKLAYVTYQD
IRKISGLKDQTVIVVKAPPETRLEVPDPLESLQIHLSSNQGPIEVYLCPEENETHSPVKS
YNQDHNGNIPKSSSKDLASTNSGHADCSISMANLSPLASPTNLLQQTEDQIPSNLEGPFV
NLLPPLIQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgagaaaggggatccaacccgccctggagcagttcctggtgaccgccgggggtggggag
ggggcggccgccgtcgccgccgccgccgctgctgctgcagcctccatggacaaaagggca
ctgctggccagccccggcttccccgccaccgccgcccccggcacttacatccagatcctc
accacgaacactaccacctcctcctcctgttcctcctcccttcaaagtgggggtgctacc
actggcccccagcacactaacatccccggcgtggagcagaccgccagcagcttcctctac
tccaccccgcatggaccctccagccgagccgggctgctgcaacagcaaccagccttagga
cgaggcggcggcggcggccctccggcaaaacgaaggctggaactaggagaaagtggtcat
cagtttctctcagatggtctaaaaaccccaaaaggcaaaggaagagccgcagtaagaagt
ccagatagtccaaaaactccaaaatctccctcagaaaaaacacggtatgatacgtcactt
ggtctgctcaccaagaagttcattcagctattgagccaatccccagatggggtcttggat
ttgaacaaggcagccgaagtgcttaaagtgcaaaagaggagaatctatgatatcaccaat
gtgctggaaggcatccacctcattaagaagaaatctaaaaacaacgtacagtggatgggc
tgcagtctctctgatgatgggggcatgttggctcagtgtcaaggtttatcaaaggaggtg
acggaactcagtcaggaagagaagaagctagatgaactgattcaaagctgcaccctagac
cttaagctgttaacagaagatgcagaaaatcaaaaattagcttatgttacatatcaagat
atccgaaaaattagtggccttaaagaccaaactgttattgttgtgaaagcccctccagaa
acaagacttgaagtgcctgatcccttagagagcctacaaatacatttatcaagtaaccaa
ggacctattgaagtttacctgtgtccagaagagaatgaaacacacagtccagtaaaatcc
tacaaccaagaccacaatgggaatattcccaaatccagttccaaagacttggcctcaacc
aactcaggacatgctgactgctccatttctatggcaaacctttctcccttggcttctcca
actaatctgcttcagcagactgaggaccaaattccttcaaacctagaaggaccatttgtg
aacttattgcctcccttaatccaagaagactacctactcagccttggggaagaagaaggc
atcagtgatctcttcgatgcttatgatttagaaaaacttccattggtggaggactttatg
tgcagttga

KEGG   Sarcophilus harrisii (Tasmanian devil): 116421696
Entry
116421696         CDS       T02286                                 

Gene name
E2F1
Definition
(RefSeq) transcription factor E2F1 isoform X1
  KO
K17454  transcription factor E2F1
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01522  Endocrine resistance
shr04110  Cell cycle
shr04137  Mitophagy - animal
shr04218  Cellular senescence
shr04934  Cushing syndrome
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05163  Human cytomegalovirus infection
shr05165  Human papillomavirus infection
shr05166  Human T-cell leukemia virus 1 infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05169  Epstein-Barr virus infection
shr05200  Pathways in cancer
shr05206  MicroRNAs in cancer
shr05212  Pancreatic cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05218  Melanoma
shr05219  Bladder cancer
shr05220  Chronic myeloid leukemia
shr05222  Small cell lung cancer
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    116421696 (E2F1)
  09143 Cell growth and death
   04110 Cell cycle
    116421696 (E2F1)
   04218 Cellular senescence
    116421696 (E2F1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    116421696 (E2F1)
   05206 MicroRNAs in cancer
    116421696 (E2F1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    116421696 (E2F1)
   05225 Hepatocellular carcinoma
    116421696 (E2F1)
   05226 Gastric cancer
    116421696 (E2F1)
   05214 Glioma
    116421696 (E2F1)
   05220 Chronic myeloid leukemia
    116421696 (E2F1)
   05218 Melanoma
    116421696 (E2F1)
   05219 Bladder cancer
    116421696 (E2F1)
   05215 Prostate cancer
    116421696 (E2F1)
   05224 Breast cancer
    116421696 (E2F1)
   05222 Small cell lung cancer
    116421696 (E2F1)
   05223 Non-small cell lung cancer
    116421696 (E2F1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    116421696 (E2F1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    116421696 (E2F1)
   05161 Hepatitis B
    116421696 (E2F1)
   05160 Hepatitis C
    116421696 (E2F1)
   05163 Human cytomegalovirus infection
    116421696 (E2F1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    116421696 (E2F1)
   05169 Epstein-Barr virus infection
    116421696 (E2F1)
   05165 Human papillomavirus infection
    116421696 (E2F1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    116421696 (E2F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:shr03000]
    116421696 (E2F1)
Transcription factors [BR:shr03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    116421696 (E2F1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP B-block_TFIIIC
Other DBs
NCBI-GeneID: 116421696
NCBI-ProteinID: XP_031809720
LinkDB
Position
2
AA seq 439 aa
MALDGSGGGGGGTCVAELEALLGAGGLQLLEQQIVIISTQDEGPLSAAAVPVTAEGPREA
ELLLFATPQAPRPGASGPRPALGRPPVKRKLDLETDHQYIAEGSQPTRARPRPPGKAGVK
SPGEKSRYETSLNLTTKRFLELLNQSTDGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLI
TKKSKNHIQWLGNHSVAVNTSKQQMLAKDLHHLQEAERQLDDLIQMCTVQLKLLTEDADN
QHLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAADPAEAFQISLKSSRGPIDVFLCPE
ESSDVCSPVKSPFKATPEETGLSLEPTLPPQPPPPPPSPLTASIQDGNLPLLTSEQEHLL
SRASPASLRASTEDGRLSPLVSVDSLLDQVKEDFSSLLPDEFISLSPPQGQDYHFGLEEG
EGIRELFDCDFGDFTPLDF
NT seq 1320 nt   +upstreamnt  +downstreamnt
atggccctggacggcagcggcggcggcggcggcggcacgtgcgtggcggagctggaggcc
ctgctgggggctggggggctgcagctgctggagcagcagatcgtcatcatctccacccag
gacgaaggcccgctcagcgctgccgccgtcccggtcaccgcagaggggccccgagaggcc
gagttgctgctgttcgcaacgccccaggcgccccggccgggagccagcggccccaggcct
gccctgggccggcctccggtgaaaaggaaactggacttggaaacagaccatcagtacata
gctgaaggcagtcagccaacccgggccaggcccagaccccctggcaaagcaggtgtgaag
tccccaggggagaagtctcgctacgagacctcactgaacctgactaccaaacgcttcctg
gagttactgaaccagtctacggatggcgtggtggacctgaactgggcagccgaggtgctg
aaggtgcagaagaggcgcatctatgacatcaccaacgtgctcgagggcatccagctcatc
accaagaagtccaagaaccacatccagtggcttgggaatcattctgtagccgtcaacacc
agcaagcagcagatgctagctaaggacttgcatcatctccaggaggctgagaggcagctg
gatgacttgatccagatgtgcaccgttcagctcaaactgctcactgaagatgccgacaat
cagcacttagcctatgtgacctgccaagacctacgaagtatagcagaccctgcagagcag
atggtgatggtgattaaggccccacctgagacacagctacaagcagcagaccctgcagag
gcattccagatctccctgaaaagcagccgaggtcccatcgacgtgtttctgtgccctgag
gaaagctcggatgtgtgcagtccagtgaagagtccctttaaagcaactcctgaggagact
ggcctcagtctggagcccacccttcccccccagccgccgccaccacctccaagccccctc
acagcttccatacaggatggcaacttgcccctgctcaccagcgagcaagaacacctcctg
tccagggcaagcccggcatccctcagagcctcaacagaagatggacgcttgtctccacta
gtgtctgtggacagcctcctggaccaagtgaaggaggatttctccagccttctgccagat
gagttcatcagcctctcccctcctcagggccaggactatcactttggcctggaggaagga
gagggcattagggaactctttgactgtgactttggggacttcacccccctagatttctga

DBGET integrated database retrieval system