KEGG   Sarcophilus harrisii (Tasmanian devil): 100924154
Entry
100924154         CDS       T02286                                 

Gene name
CDK6
Definition
(RefSeq) cyclin-dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04110  Cell cycle
shr04115  p53 signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04218  Cellular senescence
shr04934  Cushing syndrome
shr05160  Hepatitis C
shr05162  Measles
shr05163  Human cytomegalovirus infection
shr05164  Influenza A
shr05165  Human papillomavirus infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05169  Epstein-Barr virus infection
shr05200  Pathways in cancer
shr05203  Viral carcinogenesis
shr05206  MicroRNAs in cancer
shr05212  Pancreatic cancer
shr05214  Glioma
shr05218  Melanoma
shr05220  Chronic myeloid leukemia
shr05222  Small cell lung cancer
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100924154 (CDK6)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100924154 (CDK6)
   04115 p53 signaling pathway
    100924154 (CDK6)
   04218 Cellular senescence
    100924154 (CDK6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100924154 (CDK6)
   05206 MicroRNAs in cancer
    100924154 (CDK6)
   05203 Viral carcinogenesis
    100924154 (CDK6)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100924154 (CDK6)
   05225 Hepatocellular carcinoma
    100924154 (CDK6)
   05214 Glioma
    100924154 (CDK6)
   05220 Chronic myeloid leukemia
    100924154 (CDK6)
   05218 Melanoma
    100924154 (CDK6)
   05224 Breast cancer
    100924154 (CDK6)
   05222 Small cell lung cancer
    100924154 (CDK6)
   05223 Non-small cell lung cancer
    100924154 (CDK6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100924154 (CDK6)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100924154 (CDK6)
   05164 Influenza A
    100924154 (CDK6)
   05162 Measles
    100924154 (CDK6)
   05163 Human cytomegalovirus infection
    100924154 (CDK6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100924154 (CDK6)
   05169 Epstein-Barr virus infection
    100924154 (CDK6)
   05165 Human papillomavirus infection
    100924154 (CDK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100924154 (CDK6)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100924154 (CDK6)
Protein kinases [BR:shr01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100924154 (CDK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo RIO1 Kinase-like FTA2 Seadorna_VP7
Other DBs
NCBI-GeneID: 100924154
NCBI-ProteinID: XP_031795876
LinkDB
Position
5
AA seq 326 aa
MDKDGLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPDPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSNGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPNDVALPRQAFNAKSPQPIEKFVTDIDELGKDLLMKCLTFNPAKRISACSALSHPYF
HDVEKPHENVDPRTSPSQSSSEGNSA
NT seq 981 nt   +upstreamnt  +downstreamnt
atggacaaggacggcctgagccgggctgaccagcagtacgagtgcgtggccgagatcggc
gagggcgcctacgggaaggtgttcaaggcccgggacctgaagaacggaggccgtttcgtg
gcgctgaagcgcgtgcgggtgcagaccggggaggagggcatgccgctctccaccatccgc
gaggtggcggtgttgaggcacctggagaccttcgagcaccccaacgtggtcaggttgttt
gatgtatgtacagtctcacggacagacagggagaccaagcttacgctagtgttcgaacac
gttgatcaagacttgaccacctatttggataaagttccagacccaggagtacccacggaa
acaatcaaggacatgatgtttcaactgctccgaggtctggattttcttcattcacaccga
gtagtgcaccgtgatctgaaaccacagaatatccttgtcaccagcaatggacagattaaa
ctggccgattttggccttgcccggatctacagtttccaaatggctcttacctcagtggtt
gtcactttatggtacagagcacctgaagtcctgcttcagtccagttacgccacgccagtg
gacctgtggagcgtgggctgcatatttgcagaaatgtttcgtagaaagcctctttttcgt
ggaagttcagacgtcgatcaactaggaaaaatcttggatgtcattggacttccaggtgaa
gaagactggccaaatgacgtggcccttcccaggcaggcttttaatgcaaaatctccccaa
ccaatcgaaaagtttgtaacagatattgatgagctaggcaaagacttacttatgaagtgc
ttgacattcaacccagcaaaaagaatctcggcttgcagtgcattgtctcacccatatttc
catgatgtagagaaacctcatgagaatgtggaccctcggacatcccccagccaaagcagc
agtgagggcaacagtgcttga

KEGG   Sarcophilus harrisii (Tasmanian devil): 100932899
Entry
100932899         CDS       T02286                                 

Gene name
CDK4
Definition
(RefSeq) cyclin-dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01522  Endocrine resistance
shr04110  Cell cycle
shr04115  p53 signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04218  Cellular senescence
shr04530  Tight junction
shr04660  T cell receptor signaling pathway
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr04934  Cushing syndrome
shr05160  Hepatitis C
shr05162  Measles
shr05163  Human cytomegalovirus infection
shr05164  Influenza A
shr05165  Human papillomavirus infection
shr05166  Human T-cell leukemia virus 1 infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05169  Epstein-Barr virus infection
shr05200  Pathways in cancer
shr05203  Viral carcinogenesis
shr05212  Pancreatic cancer
shr05214  Glioma
shr05218  Melanoma
shr05219  Bladder cancer
shr05220  Chronic myeloid leukemia
shr05222  Small cell lung cancer
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100932899 (CDK4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100932899 (CDK4)
   04115 p53 signaling pathway
    100932899 (CDK4)
   04218 Cellular senescence
    100932899 (CDK4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100932899 (CDK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100932899 (CDK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100932899 (CDK4)
   05203 Viral carcinogenesis
    100932899 (CDK4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100932899 (CDK4)
   05225 Hepatocellular carcinoma
    100932899 (CDK4)
   05214 Glioma
    100932899 (CDK4)
   05220 Chronic myeloid leukemia
    100932899 (CDK4)
   05218 Melanoma
    100932899 (CDK4)
   05219 Bladder cancer
    100932899 (CDK4)
   05224 Breast cancer
    100932899 (CDK4)
   05222 Small cell lung cancer
    100932899 (CDK4)
   05223 Non-small cell lung cancer
    100932899 (CDK4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100932899 (CDK4)
   04934 Cushing syndrome
    100932899 (CDK4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100932899 (CDK4)
   05160 Hepatitis C
    100932899 (CDK4)
   05164 Influenza A
    100932899 (CDK4)
   05162 Measles
    100932899 (CDK4)
   05163 Human cytomegalovirus infection
    100932899 (CDK4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100932899 (CDK4)
   05169 Epstein-Barr virus infection
    100932899 (CDK4)
   05165 Human papillomavirus infection
    100932899 (CDK4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100932899 (CDK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100932899 (CDK4)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100932899 (CDK4)
Protein kinases [BR:shr01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100932899 (CDK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like
Other DBs
NCBI-GeneID: 100932899
NCBI-ProteinID: XP_031796919
Ensembl: ENSSHAG00000009373
LinkDB
Position
5
AA seq 304 aa
MDIPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVKVPTGGGSGSGLPVSTVREVALL
RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPLETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSSGTVKLADFGLARIYSCQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLSKIFDLIGLPAEDDWPP
DVSLPRGAFTPCSPQPLQSVVPELEGPGAQLLLEMLTFSPHKRISAFRALQHTYLQTAGE
GSPE
NT seq 915 nt   +upstreamnt  +downstreamnt
atggacatccctcggtatgagccagtggccgaaattggtgtcggtgcctatgggacggtg
tacaaagcgcgtgacccccacagcgggcacttcgtggcactcaagagcgtgaaagtgccc
acaggcggcgggagtgggagcggcctgcctgtcagcacggtccgggaggtggctctcctt
cggaggctggaggcatttgagcatcccaacgttgtccggctgatggacgtctgtgccact
gcccgaactgaccgagagaccaaggtgactctggtgtttgaacacgtggaccaagacctg
aggacgtatctggacaaagcccctccaccaggcctgcccttggagaccatcaaggatcta
atgagacagttcttaagaggcctagactttcttcatgctaactgcattgtccaccgtgac
ttgaagccagaaaacatacttgtgaccagtagtggaacggtcaagctggctgactttggc
ttagctcggatctacagctgccagatggcactcacacctgtggtagtcactctctggtac
cgggcccctgaggttctcctgcagtcaacatatgcaacacctgtggacatgtggagtgtt
ggctgcatcttcgcagagatgttccgtagaaagcctctcttctgtggaaattctgaagct
gaccagttaagcaaaatcttcgatctgattgggctcccagcagaagatgattggcctcct
gatgtttctctgccccggggagcctttactccttgtagtccccagcctttacagtctgtt
gtgcctgagctggagggacctggagcacagctgctactggaaatgctgacctttagccca
cacaaacggatctctgccttccgagctcttcaacacacttacctacagacagctggggaa
gggagccccgaatga

DBGET integrated database retrieval system