KEGG   Sarcophilus harrisii (Tasmanian devil): 100924976
Entry
100924976         CDS       T02286                                 

Gene name
PIK3R1
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha isoform X2
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr01522  Endocrine resistance
shr01524  Platinum drug resistance
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04015  Rap1 signaling pathway
shr04024  cAMP signaling pathway
shr04062  Chemokine signaling pathway
shr04066  HIF-1 signaling pathway
shr04068  FoxO signaling pathway
shr04070  Phosphatidylinositol signaling system
shr04071  Sphingolipid signaling pathway
shr04072  Phospholipase D signaling pathway
shr04140  Autophagy - animal
shr04150  mTOR signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04152  AMPK signaling pathway
shr04210  Apoptosis
shr04211  Longevity regulating pathway
shr04213  Longevity regulating pathway - multiple species
shr04218  Cellular senescence
shr04360  Axon guidance
shr04370  VEGF signaling pathway
shr04380  Osteoclast differentiation
shr04510  Focal adhesion
shr04550  Signaling pathways regulating pluripotency of stem cells
shr04611  Platelet activation
shr04620  Toll-like receptor signaling pathway
shr04625  C-type lectin receptor signaling pathway
shr04630  JAK-STAT signaling pathway
shr04650  Natural killer cell mediated cytotoxicity
shr04660  T cell receptor signaling pathway
shr04662  B cell receptor signaling pathway
shr04664  Fc epsilon RI signaling pathway
shr04666  Fc gamma R-mediated phagocytosis
shr04668  TNF signaling pathway
shr04670  Leukocyte transendothelial migration
shr04722  Neurotrophin signaling pathway
shr04725  Cholinergic synapse
shr04750  Inflammatory mediator regulation of TRP channels
shr04810  Regulation of actin cytoskeleton
shr04910  Insulin signaling pathway
shr04914  Progesterone-mediated oocyte maturation
shr04915  Estrogen signaling pathway
shr04917  Prolactin signaling pathway
shr04919  Thyroid hormone signaling pathway
shr04923  Regulation of lipolysis in adipocytes
shr04926  Relaxin signaling pathway
shr04929  GnRH secretion
shr04930  Type II diabetes mellitus
shr04931  Insulin resistance
shr04932  Non-alcoholic fatty liver disease
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr04935  Growth hormone synthesis, secretion and action
shr04960  Aldosterone-regulated sodium reabsorption
shr04973  Carbohydrate digestion and absorption
shr05010  Alzheimer disease
shr05017  Spinocerebellar ataxia
shr05020  Prion disease
shr05100  Bacterial invasion of epithelial cells
shr05135  Yersinia infection
shr05142  Chagas disease
shr05146  Amoebiasis
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05162  Measles
shr05163  Human cytomegalovirus infection
shr05164  Influenza A
shr05165  Human papillomavirus infection
shr05166  Human T-cell leukemia virus 1 infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05168  Herpes simplex virus 1 infection
shr05169  Epstein-Barr virus infection
shr05170  Human immunodeficiency virus 1 infection
shr05171  Coronavirus disease - COVID-19
shr05200  Pathways in cancer
shr05203  Viral carcinogenesis
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05210  Colorectal cancer
shr05211  Renal cell carcinoma
shr05212  Pancreatic cancer
shr05213  Endometrial cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05218  Melanoma
shr05220  Chronic myeloid leukemia
shr05221  Acute myeloid leukemia
shr05222  Small cell lung cancer
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05230  Central carbon metabolism in cancer
shr05231  Choline metabolism in cancer
shr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
shr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100924976 (PIK3R1)
   04014 Ras signaling pathway
    100924976 (PIK3R1)
   04015 Rap1 signaling pathway
    100924976 (PIK3R1)
   04370 VEGF signaling pathway
    100924976 (PIK3R1)
   04630 JAK-STAT signaling pathway
    100924976 (PIK3R1)
   04668 TNF signaling pathway
    100924976 (PIK3R1)
   04066 HIF-1 signaling pathway
    100924976 (PIK3R1)
   04068 FoxO signaling pathway
    100924976 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    100924976 (PIK3R1)
   04072 Phospholipase D signaling pathway
    100924976 (PIK3R1)
   04071 Sphingolipid signaling pathway
    100924976 (PIK3R1)
   04024 cAMP signaling pathway
    100924976 (PIK3R1)
   04151 PI3K-Akt signaling pathway
    100924976 (PIK3R1)
   04152 AMPK signaling pathway
    100924976 (PIK3R1)
   04150 mTOR signaling pathway
    100924976 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100924976 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    100924976 (PIK3R1)
   04218 Cellular senescence
    100924976 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100924976 (PIK3R1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100924976 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100924976 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100924976 (PIK3R1)
   04620 Toll-like receptor signaling pathway
    100924976 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    100924976 (PIK3R1)
   04650 Natural killer cell mediated cytotoxicity
    100924976 (PIK3R1)
   04660 T cell receptor signaling pathway
    100924976 (PIK3R1)
   04662 B cell receptor signaling pathway
    100924976 (PIK3R1)
   04664 Fc epsilon RI signaling pathway
    100924976 (PIK3R1)
   04666 Fc gamma R-mediated phagocytosis
    100924976 (PIK3R1)
   04670 Leukocyte transendothelial migration
    100924976 (PIK3R1)
   04062 Chemokine signaling pathway
    100924976 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100924976 (PIK3R1)
   04923 Regulation of lipolysis in adipocytes
    100924976 (PIK3R1)
   04929 GnRH secretion
    100924976 (PIK3R1)
   04915 Estrogen signaling pathway
    100924976 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    100924976 (PIK3R1)
   04917 Prolactin signaling pathway
    100924976 (PIK3R1)
   04926 Relaxin signaling pathway
    100924976 (PIK3R1)
   04935 Growth hormone synthesis, secretion and action
    100924976 (PIK3R1)
   04919 Thyroid hormone signaling pathway
    100924976 (PIK3R1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100924976 (PIK3R1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100924976 (PIK3R1)
  09156 Nervous system
   04725 Cholinergic synapse
    100924976 (PIK3R1)
   04722 Neurotrophin signaling pathway
    100924976 (PIK3R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100924976 (PIK3R1)
  09158 Development and regeneration
   04360 Axon guidance
    100924976 (PIK3R1)
   04380 Osteoclast differentiation
    100924976 (PIK3R1)
  09149 Aging
   04211 Longevity regulating pathway
    100924976 (PIK3R1)
   04213 Longevity regulating pathway - multiple species
    100924976 (PIK3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100924976 (PIK3R1)
   05206 MicroRNAs in cancer
    100924976 (PIK3R1)
   05205 Proteoglycans in cancer
    100924976 (PIK3R1)
   05203 Viral carcinogenesis
    100924976 (PIK3R1)
   05230 Central carbon metabolism in cancer
    100924976 (PIK3R1)
   05231 Choline metabolism in cancer
    100924976 (PIK3R1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100924976 (PIK3R1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100924976 (PIK3R1)
   05212 Pancreatic cancer
    100924976 (PIK3R1)
   05225 Hepatocellular carcinoma
    100924976 (PIK3R1)
   05226 Gastric cancer
    100924976 (PIK3R1)
   05214 Glioma
    100924976 (PIK3R1)
   05221 Acute myeloid leukemia
    100924976 (PIK3R1)
   05220 Chronic myeloid leukemia
    100924976 (PIK3R1)
   05218 Melanoma
    100924976 (PIK3R1)
   05211 Renal cell carcinoma
    100924976 (PIK3R1)
   05215 Prostate cancer
    100924976 (PIK3R1)
   05213 Endometrial cancer
    100924976 (PIK3R1)
   05224 Breast cancer
    100924976 (PIK3R1)
   05222 Small cell lung cancer
    100924976 (PIK3R1)
   05223 Non-small cell lung cancer
    100924976 (PIK3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100924976 (PIK3R1)
   05017 Spinocerebellar ataxia
    100924976 (PIK3R1)
   05020 Prion disease
    100924976 (PIK3R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100924976 (PIK3R1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100924976 (PIK3R1)
   04932 Non-alcoholic fatty liver disease
    100924976 (PIK3R1)
   04931 Insulin resistance
    100924976 (PIK3R1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100924976 (PIK3R1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100924976 (PIK3R1)
   05100 Bacterial invasion of epithelial cells
    100924976 (PIK3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100924976 (PIK3R1)
   05170 Human immunodeficiency virus 1 infection
    100924976 (PIK3R1)
   05161 Hepatitis B
    100924976 (PIK3R1)
   05160 Hepatitis C
    100924976 (PIK3R1)
   05171 Coronavirus disease - COVID-19
    100924976 (PIK3R1)
   05164 Influenza A
    100924976 (PIK3R1)
   05162 Measles
    100924976 (PIK3R1)
   05168 Herpes simplex virus 1 infection
    100924976 (PIK3R1)
   05163 Human cytomegalovirus infection
    100924976 (PIK3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100924976 (PIK3R1)
   05169 Epstein-Barr virus infection
    100924976 (PIK3R1)
   05165 Human papillomavirus infection
    100924976 (PIK3R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100924976 (PIK3R1)
   05142 Chagas disease
    100924976 (PIK3R1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100924976 (PIK3R1)
   01524 Platinum drug resistance
    100924976 (PIK3R1)
   01522 Endocrine resistance
    100924976 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:shr04131]
    100924976 (PIK3R1)
Membrane trafficking [BR:shr04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100924976 (PIK3R1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 AAA_13 DUF4201 Laminin_I Mod_r Lant_dehydr_C PI_PP_I
Other DBs
NCBI-GeneID: 100924976
NCBI-ProteinID: XP_012396527
Ensembl: ENSSHAG00000008078
LinkDB
Position
1
AA seq 502 aa
MFQPFPSGFYGTLIESCRIPLQENFSTPPLNWFRQDWNQFMSQLGESWGLFLFSWWKNSF
VDFSYCWIQEYQRKTFAMHNLQTLPPKPSKPTTVTTNNGMNNNMSLQDAEWYWGDISREE
VNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVV
ELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKEDSIEAVGKKLHEYNTQFQEKSRE
YDRLYEDYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQ
RIMHNYEKLKSRISEIVDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLM
WLTQKGVRQKKLNEWLGNENTEDQYSMVEDDEDLPHHDERTWNVGSSNRSKAENLLRGKR
DGTFLVRESSKQGCFACSVVVDGEVKHCVINKTPTGYGFAEPYNLYNSLKELVLHYQHTS
LVQHNDSLNVTLAYPVNAQQRR
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgtttcagccgtttcctagtggattttatggaacgttaattgaaagctgtagaattcct
cttcaggaaaacttttctacccctcccctcaattggttcagacaggattggaaccaattt
atgagccagttgggggagtcctgggggctttttctattttcttggtggaaaaatagtttt
gtagatttttcatattgttggatccaggaatatcagaggaaaacatttgcaatgcataac
ttacaaacactgcctcccaagccatccaaacccactactgtaacaactaacaacggtatg
aataacaatatgtccttacaagatgctgagtggtactggggagacatctcaagggaagaa
gtaaatgaaaagctgcgtgatacagcagatggtacctttttggtccgagatgcttccact
aaaatgcatggggactatactcttacacttaggaaaggaggaaataataaattaatcaaa
atatttcatcgagatgggaaatatggcttctctgacccactgactttcaactctgtggtt
gaactgataaaccactaccggaatgaatctctagctcagtataatcccaaactggatgtg
aaattactttatccagtatccaaataccaacaggatcaagtagtaaaagaagatagtatt
gaagctgtaggaaaaaaattacatgaatataacactcaattccaagaaaaaagcagagaa
tatgatagattatatgaagattatactcgtacatctcaggaaatccaaatgaaaagaaca
gcaattgaagcatttaatgaaacaataaagatatttgaagaacagtgccaaacccaggaa
cggtacagcaaagaatacatagaaaagtttaaacgtgaaggaaatgaaaaagaaatacaa
aggattatgcataattatgaaaagttaaagtctcgaatcagtgaaatagtggatagtaga
cgaaggttggaggaggatttgaagaagcaagcagctgagtatcgagagattgacaagcgg
atgaacagcattaagccagatctcattcagctgaggaagacaagggaccaatacttgatg
tggttgactcagaaaggtgtccgacaaaagaagttgaatgaatggttgggcaatgaaaat
acagaagaccaatattcaatggtggaagatgacgaggatctgccgcaccatgatgagaga
acgtggaatgtgggaagcagcaacagaagcaaagcagagaacctcttgcgcggcaaacgg
gatggcactttcctggtccgagagagcagcaaacagggatgctttgcttgctctgtagtg
gtggatggtgaagtaaagcactgtgtgataaataaaacgccaactgggtatggatttgca
gagccatataatttgtacaactctctgaaagaattggtgctccattaccaacacacgtcc
ctcgtccagcacaacgactctctcaatgtcaccctagcctacccagtcaatgcacagcag
aggcgatga

KEGG   Sarcophilus harrisii (Tasmanian devil): 100926892
Entry
100926892         CDS       T02286                                 

Gene name
PIK3R2
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr01522  Endocrine resistance
shr01524  Platinum drug resistance
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04015  Rap1 signaling pathway
shr04024  cAMP signaling pathway
shr04062  Chemokine signaling pathway
shr04066  HIF-1 signaling pathway
shr04068  FoxO signaling pathway
shr04070  Phosphatidylinositol signaling system
shr04071  Sphingolipid signaling pathway
shr04072  Phospholipase D signaling pathway
shr04140  Autophagy - animal
shr04150  mTOR signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04152  AMPK signaling pathway
shr04210  Apoptosis
shr04211  Longevity regulating pathway
shr04213  Longevity regulating pathway - multiple species
shr04218  Cellular senescence
shr04360  Axon guidance
shr04370  VEGF signaling pathway
shr04380  Osteoclast differentiation
shr04510  Focal adhesion
shr04550  Signaling pathways regulating pluripotency of stem cells
shr04611  Platelet activation
shr04620  Toll-like receptor signaling pathway
shr04625  C-type lectin receptor signaling pathway
shr04630  JAK-STAT signaling pathway
shr04650  Natural killer cell mediated cytotoxicity
shr04660  T cell receptor signaling pathway
shr04662  B cell receptor signaling pathway
shr04664  Fc epsilon RI signaling pathway
shr04666  Fc gamma R-mediated phagocytosis
shr04668  TNF signaling pathway
shr04670  Leukocyte transendothelial migration
shr04722  Neurotrophin signaling pathway
shr04725  Cholinergic synapse
shr04750  Inflammatory mediator regulation of TRP channels
shr04810  Regulation of actin cytoskeleton
shr04910  Insulin signaling pathway
shr04914  Progesterone-mediated oocyte maturation
shr04915  Estrogen signaling pathway
shr04917  Prolactin signaling pathway
shr04919  Thyroid hormone signaling pathway
shr04923  Regulation of lipolysis in adipocytes
shr04926  Relaxin signaling pathway
shr04929  GnRH secretion
shr04930  Type II diabetes mellitus
shr04931  Insulin resistance
shr04932  Non-alcoholic fatty liver disease
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr04935  Growth hormone synthesis, secretion and action
shr04960  Aldosterone-regulated sodium reabsorption
shr04973  Carbohydrate digestion and absorption
shr05010  Alzheimer disease
shr05017  Spinocerebellar ataxia
shr05020  Prion disease
shr05100  Bacterial invasion of epithelial cells
shr05135  Yersinia infection
shr05142  Chagas disease
shr05146  Amoebiasis
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05162  Measles
shr05163  Human cytomegalovirus infection
shr05164  Influenza A
shr05165  Human papillomavirus infection
shr05166  Human T-cell leukemia virus 1 infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05168  Herpes simplex virus 1 infection
shr05169  Epstein-Barr virus infection
shr05170  Human immunodeficiency virus 1 infection
shr05171  Coronavirus disease - COVID-19
shr05200  Pathways in cancer
shr05203  Viral carcinogenesis
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05210  Colorectal cancer
shr05211  Renal cell carcinoma
shr05212  Pancreatic cancer
shr05213  Endometrial cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05218  Melanoma
shr05220  Chronic myeloid leukemia
shr05221  Acute myeloid leukemia
shr05222  Small cell lung cancer
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05230  Central carbon metabolism in cancer
shr05231  Choline metabolism in cancer
shr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
shr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100926892 (PIK3R2)
   04014 Ras signaling pathway
    100926892 (PIK3R2)
   04015 Rap1 signaling pathway
    100926892 (PIK3R2)
   04370 VEGF signaling pathway
    100926892 (PIK3R2)
   04630 JAK-STAT signaling pathway
    100926892 (PIK3R2)
   04668 TNF signaling pathway
    100926892 (PIK3R2)
   04066 HIF-1 signaling pathway
    100926892 (PIK3R2)
   04068 FoxO signaling pathway
    100926892 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    100926892 (PIK3R2)
   04072 Phospholipase D signaling pathway
    100926892 (PIK3R2)
   04071 Sphingolipid signaling pathway
    100926892 (PIK3R2)
   04024 cAMP signaling pathway
    100926892 (PIK3R2)
   04151 PI3K-Akt signaling pathway
    100926892 (PIK3R2)
   04152 AMPK signaling pathway
    100926892 (PIK3R2)
   04150 mTOR signaling pathway
    100926892 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100926892 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    100926892 (PIK3R2)
   04218 Cellular senescence
    100926892 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100926892 (PIK3R2)
   04550 Signaling pathways regulating pluripotency of stem cells
    100926892 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100926892 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100926892 (PIK3R2)
   04620 Toll-like receptor signaling pathway
    100926892 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    100926892 (PIK3R2)
   04650 Natural killer cell mediated cytotoxicity
    100926892 (PIK3R2)
   04660 T cell receptor signaling pathway
    100926892 (PIK3R2)
   04662 B cell receptor signaling pathway
    100926892 (PIK3R2)
   04664 Fc epsilon RI signaling pathway
    100926892 (PIK3R2)
   04666 Fc gamma R-mediated phagocytosis
    100926892 (PIK3R2)
   04670 Leukocyte transendothelial migration
    100926892 (PIK3R2)
   04062 Chemokine signaling pathway
    100926892 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100926892 (PIK3R2)
   04923 Regulation of lipolysis in adipocytes
    100926892 (PIK3R2)
   04929 GnRH secretion
    100926892 (PIK3R2)
   04915 Estrogen signaling pathway
    100926892 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    100926892 (PIK3R2)
   04917 Prolactin signaling pathway
    100926892 (PIK3R2)
   04926 Relaxin signaling pathway
    100926892 (PIK3R2)
   04935 Growth hormone synthesis, secretion and action
    100926892 (PIK3R2)
   04919 Thyroid hormone signaling pathway
    100926892 (PIK3R2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100926892 (PIK3R2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100926892 (PIK3R2)
  09156 Nervous system
   04725 Cholinergic synapse
    100926892 (PIK3R2)
   04722 Neurotrophin signaling pathway
    100926892 (PIK3R2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100926892 (PIK3R2)
  09158 Development and regeneration
   04360 Axon guidance
    100926892 (PIK3R2)
   04380 Osteoclast differentiation
    100926892 (PIK3R2)
  09149 Aging
   04211 Longevity regulating pathway
    100926892 (PIK3R2)
   04213 Longevity regulating pathway - multiple species
    100926892 (PIK3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100926892 (PIK3R2)
   05206 MicroRNAs in cancer
    100926892 (PIK3R2)
   05205 Proteoglycans in cancer
    100926892 (PIK3R2)
   05203 Viral carcinogenesis
    100926892 (PIK3R2)
   05230 Central carbon metabolism in cancer
    100926892 (PIK3R2)
   05231 Choline metabolism in cancer
    100926892 (PIK3R2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100926892 (PIK3R2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100926892 (PIK3R2)
   05212 Pancreatic cancer
    100926892 (PIK3R2)
   05225 Hepatocellular carcinoma
    100926892 (PIK3R2)
   05226 Gastric cancer
    100926892 (PIK3R2)
   05214 Glioma
    100926892 (PIK3R2)
   05221 Acute myeloid leukemia
    100926892 (PIK3R2)
   05220 Chronic myeloid leukemia
    100926892 (PIK3R2)
   05218 Melanoma
    100926892 (PIK3R2)
   05211 Renal cell carcinoma
    100926892 (PIK3R2)
   05215 Prostate cancer
    100926892 (PIK3R2)
   05213 Endometrial cancer
    100926892 (PIK3R2)
   05224 Breast cancer
    100926892 (PIK3R2)
   05222 Small cell lung cancer
    100926892 (PIK3R2)
   05223 Non-small cell lung cancer
    100926892 (PIK3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100926892 (PIK3R2)
   05017 Spinocerebellar ataxia
    100926892 (PIK3R2)
   05020 Prion disease
    100926892 (PIK3R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100926892 (PIK3R2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100926892 (PIK3R2)
   04932 Non-alcoholic fatty liver disease
    100926892 (PIK3R2)
   04931 Insulin resistance
    100926892 (PIK3R2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100926892 (PIK3R2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100926892 (PIK3R2)
   05100 Bacterial invasion of epithelial cells
    100926892 (PIK3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100926892 (PIK3R2)
   05170 Human immunodeficiency virus 1 infection
    100926892 (PIK3R2)
   05161 Hepatitis B
    100926892 (PIK3R2)
   05160 Hepatitis C
    100926892 (PIK3R2)
   05171 Coronavirus disease - COVID-19
    100926892 (PIK3R2)
   05164 Influenza A
    100926892 (PIK3R2)
   05162 Measles
    100926892 (PIK3R2)
   05168 Herpes simplex virus 1 infection
    100926892 (PIK3R2)
   05163 Human cytomegalovirus infection
    100926892 (PIK3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100926892 (PIK3R2)
   05169 Epstein-Barr virus infection
    100926892 (PIK3R2)
   05165 Human papillomavirus infection
    100926892 (PIK3R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100926892 (PIK3R2)
   05142 Chagas disease
    100926892 (PIK3R2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100926892 (PIK3R2)
   01524 Platinum drug resistance
    100926892 (PIK3R2)
   01522 Endocrine resistance
    100926892 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:shr04131]
    100926892 (PIK3R2)
Membrane trafficking [BR:shr04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100926892 (PIK3R2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 Ribosomal_L22e Mod_r
Other DBs
NCBI-GeneID: 100926892
NCBI-ProteinID: XP_031804078
Ensembl: ENSSHAG00000009738
LinkDB
Position
1
AA seq 738 aa
MASAEGFQYRALYQYHKEREEDLDLLPGDILVVSKGTLEALGFQDGDEQSPHHIGWILGI
NERTKQKGDFPGTYVEYLGPVKIALPSHRPRGHRPLPATPGPGPVRPRDSPEPAGALLPD
LPEQFVPPEAAPPILQKLVEAIERKGLDSEMLYRPSGSELRPLRIDWTLSDVDQWDVITL
SEALKSYLQALPRPLVPPGVHGDVLHALQETTSPAAATAAAGWRRQQLQAVLEPPLVPLH
NALTLRFLLQHLGRVARQAQAQAQGSGLGSRALGEIFGPLLFRLPASGPEQTPDFSALFL
EMLLQDQEEEQEPPPPALPPKPPKPKVQAGGLSNGSSAPLQEAEWYWGDISREEVNEKLR
DTPDGTFLVRDASSKIQGEYTLTLRKGGNNKLIKVFHRDGQYGFSEPLTFGSVVELITHY
RHESLAQYNAKLDTRLLYPVSKYQQDQVVKEDSVEAVGEQLKVYHQQYQDKSREYDLLYE
EYTRTSQELQMKRTAIEAFNETIKIFEEQGQTQEKCSKDYLERFRREGNEKEIQRILMNS
EKLKSRIAEIHDSKMKLEQDLRAQAADNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKG
ARQKKINEWLGIKNETEDQYSMVDEEEDLPHHEERTWYVGKINRGRAEEMLSGKRDGTFL
IRESSQRGCYACSVVVDGDTKHCVIYKTVTGYGFAEPYNLYASLKDLVLHYKHTSLVQHN
DSLNVTLAHPVLSPPPAR
NT seq 2217 nt   +upstreamnt  +downstreamnt
atggccagtgccgagggcttccagtaccgggccctttaccagtaccacaaggagcgtgag
gaggacctcgacctgctacctggagacatcctggtggtgagcaagggcacactggaggcg
ctcggcttccaggatggggacgagcagagtccccaccacatcggctggatcctcggcatc
aacgagcgcaccaagcagaagggagacttcccgggcacctacgtggagtacctggggcct
gtgaagattgccctgccctcccaccgtccccgaggccacaggccactgcctgccacgcca
gggccagggcccgtccgtccccgggactccccggagccagctggtgccctgctccctgac
ctgccagagcagtttgtgccccctgaggcagccccacccattcttcagaagttggtggaa
gccatcgaacgcaaagggctggacagtgagatgctctacagaccatctggttctgagctg
cggcccctgagaattgactggactctgagtgacgtggatcagtgggatgtgatcactctc
tctgaggccctgaagagctacttacaagctttgcccaggcctctagtgccccccggagtc
catggggatgttcttcatgccttgcaggagaccaccagtccggccgcagccacggcagca
gcagggtggaggaggcagcagctgcaggcggtgctggagccccccctcgtccccctgcac
aatgccctgactctgcgcttcctgctccagcacctggggagggtggcccggcaggcccag
gcccaagcgcagggcagcggcctgggctcccgggcgctgggcgagatctttggacctctc
ctgtttagactgccggcctctgggcctgagcagacccctgacttctcagctctgttcctg
gaaatgctgctgcaggaccaggaggaggagcaggagccaccgcccccagctctgcctccg
aagcctcccaaacccaaggtccaggctggtggcctgtccaacgggagcagtgcccccctc
caggaagccgagtggtactggggagacatttctagggaagaggtgaatgagaaacttcgg
gacacaccagatggtaccttcttagtccgggatgcctcgagcaagatccagggtgaatac
acgctgaccctcaggaagggcggcaataacaagctgatcaaagtcttccatcgagatgga
cagtacggcttctcagagcccctgacctttggctccgtggtggagctcatcacccactac
agacacgagtctctggcccagtacaacgccaagctggacactcgcttgctctatcctgtg
tccaagtaccagcaggaccaggtggtgaaggaggacagcgtcgaggcagtgggggagcag
ctgaaggtttaccatcagcagtatcaggacaagagtcgggagtatgacctgctctatgag
gaatatacgcgcacttctcaggagctgcagatgaagcggacagccattgaggccttcaac
gagaccatcaaaatcttcgaggagcagggccagacacaggagaagtgcagcaaagattac
ctagaacgcttccggcgagaggggaacgagaaggagattcagcgaatcctcatgaattcc
gagaaactcaagtcccgaatagccgagattcacgacagcaagatgaagttggagcaggac
ctgcgggcacaggcggccgacaaccgggagatcgacaagcgcatgaacagcctcaagcct
gacctcatgcagctgcggaaaatccgggaccagtatctcgtgtggctgacccagaaggga
gctcggcagaagaagattaatgagtggctgggaatcaagaacgagactgaagaccagtac
tccatggtggacgaggaggaggacctgccccatcatgaggaaaggacttggtatgtcggg
aagatcaaccgcgggcgagcggaggagatgctgagcggcaaaagggacggcaccttcctc
atccgggagagcagccagaggggctgttacgcctgctctgtggtggtggacggggacacc
aaacactgcgtcatctacaagacggtgaccggctacggcttcgccgagccctacaacctc
tacgcctccctcaaagacttggtgctacactacaagcatacgtcgctggttcagcataat
gactccctcaatgtgacgctggcccaccccgtgctgtcgcctccccccgcccgctga

KEGG   Sarcophilus harrisii (Tasmanian devil): 100929811
Entry
100929811         CDS       T02286                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00562  Inositol phosphate metabolism
shr01100  Metabolic pathways
shr01521  EGFR tyrosine kinase inhibitor resistance
shr01522  Endocrine resistance
shr01524  Platinum drug resistance
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04015  Rap1 signaling pathway
shr04024  cAMP signaling pathway
shr04062  Chemokine signaling pathway
shr04066  HIF-1 signaling pathway
shr04068  FoxO signaling pathway
shr04070  Phosphatidylinositol signaling system
shr04071  Sphingolipid signaling pathway
shr04072  Phospholipase D signaling pathway
shr04140  Autophagy - animal
shr04150  mTOR signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04152  AMPK signaling pathway
shr04210  Apoptosis
shr04211  Longevity regulating pathway
shr04213  Longevity regulating pathway - multiple species
shr04218  Cellular senescence
shr04360  Axon guidance
shr04370  VEGF signaling pathway
shr04380  Osteoclast differentiation
shr04510  Focal adhesion
shr04550  Signaling pathways regulating pluripotency of stem cells
shr04611  Platelet activation
shr04620  Toll-like receptor signaling pathway
shr04625  C-type lectin receptor signaling pathway
shr04630  JAK-STAT signaling pathway
shr04650  Natural killer cell mediated cytotoxicity
shr04660  T cell receptor signaling pathway
shr04662  B cell receptor signaling pathway
shr04664  Fc epsilon RI signaling pathway
shr04666  Fc gamma R-mediated phagocytosis
shr04668  TNF signaling pathway
shr04670  Leukocyte transendothelial migration
shr04722  Neurotrophin signaling pathway
shr04725  Cholinergic synapse
shr04750  Inflammatory mediator regulation of TRP channels
shr04810  Regulation of actin cytoskeleton
shr04910  Insulin signaling pathway
shr04914  Progesterone-mediated oocyte maturation
shr04915  Estrogen signaling pathway
shr04917  Prolactin signaling pathway
shr04919  Thyroid hormone signaling pathway
shr04923  Regulation of lipolysis in adipocytes
shr04926  Relaxin signaling pathway
shr04929  GnRH secretion
shr04930  Type II diabetes mellitus
shr04931  Insulin resistance
shr04932  Non-alcoholic fatty liver disease
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr04935  Growth hormone synthesis, secretion and action
shr04960  Aldosterone-regulated sodium reabsorption
shr04973  Carbohydrate digestion and absorption
shr05010  Alzheimer disease
shr05017  Spinocerebellar ataxia
shr05020  Prion disease
shr05100  Bacterial invasion of epithelial cells
shr05132  Salmonella infection
shr05135  Yersinia infection
shr05142  Chagas disease
shr05146  Amoebiasis
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05162  Measles
shr05163  Human cytomegalovirus infection
shr05164  Influenza A
shr05165  Human papillomavirus infection
shr05166  Human T-cell leukemia virus 1 infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05168  Herpes simplex virus 1 infection
shr05169  Epstein-Barr virus infection
shr05170  Human immunodeficiency virus 1 infection
shr05171  Coronavirus disease - COVID-19
shr05200  Pathways in cancer
shr05203  Viral carcinogenesis
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05210  Colorectal cancer
shr05211  Renal cell carcinoma
shr05212  Pancreatic cancer
shr05213  Endometrial cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05218  Melanoma
shr05220  Chronic myeloid leukemia
shr05221  Acute myeloid leukemia
shr05222  Small cell lung cancer
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05230  Central carbon metabolism in cancer
shr05231  Choline metabolism in cancer
shr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
shr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100929811 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100929811 (PIK3CB)
   04014 Ras signaling pathway
    100929811 (PIK3CB)
   04015 Rap1 signaling pathway
    100929811 (PIK3CB)
   04370 VEGF signaling pathway
    100929811 (PIK3CB)
   04630 JAK-STAT signaling pathway
    100929811 (PIK3CB)
   04668 TNF signaling pathway
    100929811 (PIK3CB)
   04066 HIF-1 signaling pathway
    100929811 (PIK3CB)
   04068 FoxO signaling pathway
    100929811 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    100929811 (PIK3CB)
   04072 Phospholipase D signaling pathway
    100929811 (PIK3CB)
   04071 Sphingolipid signaling pathway
    100929811 (PIK3CB)
   04024 cAMP signaling pathway
    100929811 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    100929811 (PIK3CB)
   04152 AMPK signaling pathway
    100929811 (PIK3CB)
   04150 mTOR signaling pathway
    100929811 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100929811 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    100929811 (PIK3CB)
   04218 Cellular senescence
    100929811 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100929811 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    100929811 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100929811 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100929811 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    100929811 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    100929811 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    100929811 (PIK3CB)
   04660 T cell receptor signaling pathway
    100929811 (PIK3CB)
   04662 B cell receptor signaling pathway
    100929811 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    100929811 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    100929811 (PIK3CB)
   04670 Leukocyte transendothelial migration
    100929811 (PIK3CB)
   04062 Chemokine signaling pathway
    100929811 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100929811 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    100929811 (PIK3CB)
   04929 GnRH secretion
    100929811 (PIK3CB)
   04915 Estrogen signaling pathway
    100929811 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    100929811 (PIK3CB)
   04917 Prolactin signaling pathway
    100929811 (PIK3CB)
   04926 Relaxin signaling pathway
    100929811 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    100929811 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    100929811 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100929811 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100929811 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    100929811 (PIK3CB)
   04722 Neurotrophin signaling pathway
    100929811 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100929811 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    100929811 (PIK3CB)
   04380 Osteoclast differentiation
    100929811 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    100929811 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    100929811 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100929811 (PIK3CB)
   05206 MicroRNAs in cancer
    100929811 (PIK3CB)
   05205 Proteoglycans in cancer
    100929811 (PIK3CB)
   05203 Viral carcinogenesis
    100929811 (PIK3CB)
   05230 Central carbon metabolism in cancer
    100929811 (PIK3CB)
   05231 Choline metabolism in cancer
    100929811 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100929811 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100929811 (PIK3CB)
   05212 Pancreatic cancer
    100929811 (PIK3CB)
   05225 Hepatocellular carcinoma
    100929811 (PIK3CB)
   05226 Gastric cancer
    100929811 (PIK3CB)
   05214 Glioma
    100929811 (PIK3CB)
   05221 Acute myeloid leukemia
    100929811 (PIK3CB)
   05220 Chronic myeloid leukemia
    100929811 (PIK3CB)
   05218 Melanoma
    100929811 (PIK3CB)
   05211 Renal cell carcinoma
    100929811 (PIK3CB)
   05215 Prostate cancer
    100929811 (PIK3CB)
   05213 Endometrial cancer
    100929811 (PIK3CB)
   05224 Breast cancer
    100929811 (PIK3CB)
   05222 Small cell lung cancer
    100929811 (PIK3CB)
   05223 Non-small cell lung cancer
    100929811 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100929811 (PIK3CB)
   05017 Spinocerebellar ataxia
    100929811 (PIK3CB)
   05020 Prion disease
    100929811 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100929811 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100929811 (PIK3CB)
   04932 Non-alcoholic fatty liver disease
    100929811 (PIK3CB)
   04931 Insulin resistance
    100929811 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100929811 (PIK3CB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100929811 (PIK3CB)
   05135 Yersinia infection
    100929811 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    100929811 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100929811 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    100929811 (PIK3CB)
   05161 Hepatitis B
    100929811 (PIK3CB)
   05160 Hepatitis C
    100929811 (PIK3CB)
   05171 Coronavirus disease - COVID-19
    100929811 (PIK3CB)
   05164 Influenza A
    100929811 (PIK3CB)
   05162 Measles
    100929811 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    100929811 (PIK3CB)
   05163 Human cytomegalovirus infection
    100929811 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100929811 (PIK3CB)
   05169 Epstein-Barr virus infection
    100929811 (PIK3CB)
   05165 Human papillomavirus infection
    100929811 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100929811 (PIK3CB)
   05142 Chagas disease
    100929811 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100929811 (PIK3CB)
   01524 Platinum drug resistance
    100929811 (PIK3CB)
   01522 Endocrine resistance
    100929811 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:shr04131]
    100929811 (PIK3CB)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100929811 (PIK3CB)
Membrane trafficking [BR:shr04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100929811 (PIK3CB)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_p85B PI3K_rbd PI3K_C2 RWD Tom37_C DUF4381
Other DBs
NCBI-GeneID: 100929811
NCBI-ProteinID: XP_031815674
Ensembl: ENSSHAG00000000088
LinkDB
Position
3
AA seq 1069 aa
MCLSFIMPPAMADNLDIWAVDSQIASDGSIPVDFLLPTGIYIQLEVPREATISNIKQMLW
KQAHNYPMFNLLMEIESYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKVITRNCDPGE
KLDSKIGVLIGKGLHEFDALEDPEVNEFRSKMRQFSEEKIQSLVGLSWIEWLKHTYPPEQ
EPSIPENLEDKLYGGNLVIAVHFENCQDVFSFQVSPNMSPIKLNELVVRKRLTIHGKEDE
VDPYDYVLQVSGRLEFVFGDHPLIQFQYIRNCVMNRTLPKLTLVECCNIKKMFEQEMIAI
EAAINRNSSNLPLPLPPKKTRLISNVWDNTQPFQVILVKGTKLNTEESVKVHVRAGLFHG
TELLCKPVVSSEISGRNDHVWSEPLEFDINICDLPRMARLCFAVYAVDKVKTKKSTKTIN
PSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLKSGDIILHSWSSFPDELEEMLNPMGTVQT
NPYFENATTLHVKFPENKKQPYYYPPFDKIIEKAAEIASSDSGNVSSRGGKKFHAVLKEI
MERDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSVKWNKLEDVAQLQALLQIWPKL
PPREALELLDFNYPDQYVREYAVGCLKQMSDEELSQYLLQLVQVLKYEPFLDCALSRFML
DRALANRRIGQFLFWHLRSEVHIPAFSVQFGVILEAYCRGSVGYMKVLSKQVEALNKLKT
LNSLIKLNAVKLNKAKGREAMHTCLKQNAYREALSDLQSPLNPCVILSELYVEKCKYMDS
KMKPLRIVYNNKVFGGDPLGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYGC
LATGDRSGLIEVVSTSETIADIQLNSSNVAATAAFNKDALLNWLKEYNSGDDLDRAIEEF
TLSCAGYCVASYVLGIGDRHSDNIMVRKTGQLFHIDFGHILGNFKSKFGIKRERVPFILT
YDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKDI
QYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTMRKDYRS
NT seq 3210 nt   +upstreamnt  +downstreamnt
atgtgcctcagttttataatgcctcctgctatggcagacaaccttgacatttgggctgtg
gattctcagatagcatcagatggctccattcccgtggattttttattgcccacggggatc
tatatacaattggaagtacctcgggaggccactatttctaatattaaacagatgctatgg
aagcaagctcacaactaccctatgtttaaccttcttatggaaattgaatcttatatgttt
gcatgtgtgaatcaaactgctgtttatgaggagcttgaagatgaaacaagaagactctgt
gatgtcagaccttttcttccagttctcaaagtgataacaagaaattgtgacccaggggaa
aaattagactccaaaattggagttcttataggaaaaggtctccatgagtttgatgccctg
gaagatcctgaggtgaatgaattccgaagtaagatgcgccagttcagtgaagaaaagatc
cagtcccttgtgggattatcttggatagaatggttaaagcatacttacccaccagaacaa
gaaccttccattcctgaaaatttggaagataaactttatggtggaaatcttgtgattgct
gtccattttgaaaattgccaggatgtatttagtttccaagtatctcctaatatgagtccc
atcaaattaaatgagttggtagtccgaaaacggttgactatccacggaaaggaagatgaa
gttgatccctatgactatgtgctgcaagtcagtgggagactagaatttgtgttcggtgat
caccctttaattcagttccagtatatccggaactgtgtcatgaatagaactcttcccaaa
ctcactcttgttgaatgttgcaatataaagaagatgtttgaacaggaaatgattgccata
gaagcggccataaatcgaaattcatccaaccttcctcttccactgccccccaaaaaaaca
cgattaatttctaatgtttgggataatactcagcctttccaagttatattggttaaagga
actaaactgaacacagaagaaagcgtcaaagttcatgtcagggctggactttttcatgga
actgaacttctttgtaaaccagttgtaagctcagagatatctgggagaaatgaccatgtt
tggagtgaaccactggaatttgatattaacatctgtgatttaccaagaatggctaggtta
tgctttgcagtttatgctgtggataaagtgaaaacaaaaaagtcaactaagacaattaat
ccttccaaatatcagactatcaggaaagctggaaaagtgcactatcctgtggcatgggta
aacaccatggtgtttgacttcaaaggacagctgaaaagtggagacatcatattgcacagc
tggtcatcatttcctgacgaacttgaagaaatgttgaatccaatgggaactgttcaaaca
aatccatattttgaaaatgcaacaactttacatgttaaattccctgagaataaaaaacag
ccttattattaccctccttttgataagattattgaaaaggcagctgaaattgcaagtagt
gacagtggtaatgtatctagtcgaggtgggaaaaaatttcatgctgtgctcaaagaaatc
atggagagggatcccttatcccaactatgtgagaatgaaatggatcttatttggactttg
agacaagactgtagagaaaattttcctcagtcactgccaaaattgctgctgtctgtcaaa
tggaacaaacttgaagatgttgctcagctacaggctcttcttcagatatggcctaaactg
cctcctagagaagcattggaattattagactttaattatccagaccagtatgtaagggag
tatgcagtgggctgcttgaaacaaatgagtgatgaagaactatctcagtatcttctacaa
cttgtacaagttttgaaatatgaaccttttcttgattgtgccctatctagatttatgtta
gacagagcacttgctaataggaggatagggcagtttctattttggcatcttaggtcagag
gtgcacattcctgccttttcagtgcagtttggtgtaatacttgaagcttactgtcgagga
agtgtgggctatatgaaagtgctttctaaacaggttgaagctcttaataagctgaagacc
ttaaatagtttaataaaattgaatgcagtaaagttaaacaaagcaaaaggaagagaagca
atgcatacatgcttaaaacaaaatgcttaccgagaagccctttctgatcttcagtcacct
ttgaatccctgtgtcatcctttcagaactttatgttgaaaagtgcaagtacatggattct
aaaatgaagcctctgagaatagtatacaataacaaagtatttggaggagatccattgggt
gtcatttttaaaaatggggatgatctacggcaagatatgttgactctccaaatgttgcgg
ttaatggatttactttggaaagaggctggattggatcttcgaatgctcccatatggttgt
ttagcaacaggagaccgttctggcctaattgaagttgtcagtacttctgaaacaattgca
gatattcagctaaatagtagtaatgttgctgctacagctgccttcaataaagatgctctt
ctaaactggcttaaagaatacaattcgggggatgacttagatcgagccattgaagagttc
actctctcttgtgctggctactgtgtagcttcttatgtcttaggaattggtgatagacat
agtgacaatatcatggtcaggaagactggacagcttttccacattgattttggacatatt
cttggaaacttcaaatctaaatttggcattaaacgggaacgagtgcctttcattcttacc
tatgattttattcatgtcattcagcaaggaaaaacaggaaacacagaaaagtttggccga
tttcgtcagtgttgtgaagatgcttacttgattttacgaaggcatgggaatctctttatc
actctgtttgctctgatgttgacagcaggacttcctgagctcacctccgtcaaggatata
cagtatcttaaggactctttggccttggggaagagtgaggaagaagcactaaagcaattt
aagcagaaatttgatgaagctctcagggaaagttggactactaaagtaaactggatggca
cacaccatgaggaaagattaccggtcttaa

KEGG   Sarcophilus harrisii (Tasmanian devil): 100932099
Entry
100932099         CDS       T02286                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00562  Inositol phosphate metabolism
shr01100  Metabolic pathways
shr01521  EGFR tyrosine kinase inhibitor resistance
shr01522  Endocrine resistance
shr01524  Platinum drug resistance
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04015  Rap1 signaling pathway
shr04024  cAMP signaling pathway
shr04062  Chemokine signaling pathway
shr04066  HIF-1 signaling pathway
shr04068  FoxO signaling pathway
shr04070  Phosphatidylinositol signaling system
shr04071  Sphingolipid signaling pathway
shr04072  Phospholipase D signaling pathway
shr04140  Autophagy - animal
shr04150  mTOR signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04152  AMPK signaling pathway
shr04210  Apoptosis
shr04211  Longevity regulating pathway
shr04213  Longevity regulating pathway - multiple species
shr04218  Cellular senescence
shr04360  Axon guidance
shr04370  VEGF signaling pathway
shr04380  Osteoclast differentiation
shr04510  Focal adhesion
shr04550  Signaling pathways regulating pluripotency of stem cells
shr04611  Platelet activation
shr04620  Toll-like receptor signaling pathway
shr04625  C-type lectin receptor signaling pathway
shr04630  JAK-STAT signaling pathway
shr04650  Natural killer cell mediated cytotoxicity
shr04660  T cell receptor signaling pathway
shr04662  B cell receptor signaling pathway
shr04664  Fc epsilon RI signaling pathway
shr04666  Fc gamma R-mediated phagocytosis
shr04668  TNF signaling pathway
shr04670  Leukocyte transendothelial migration
shr04722  Neurotrophin signaling pathway
shr04725  Cholinergic synapse
shr04750  Inflammatory mediator regulation of TRP channels
shr04810  Regulation of actin cytoskeleton
shr04910  Insulin signaling pathway
shr04914  Progesterone-mediated oocyte maturation
shr04915  Estrogen signaling pathway
shr04917  Prolactin signaling pathway
shr04919  Thyroid hormone signaling pathway
shr04923  Regulation of lipolysis in adipocytes
shr04926  Relaxin signaling pathway
shr04929  GnRH secretion
shr04930  Type II diabetes mellitus
shr04931  Insulin resistance
shr04932  Non-alcoholic fatty liver disease
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr04935  Growth hormone synthesis, secretion and action
shr04960  Aldosterone-regulated sodium reabsorption
shr04973  Carbohydrate digestion and absorption
shr05010  Alzheimer disease
shr05017  Spinocerebellar ataxia
shr05020  Prion disease
shr05100  Bacterial invasion of epithelial cells
shr05132  Salmonella infection
shr05135  Yersinia infection
shr05142  Chagas disease
shr05146  Amoebiasis
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05162  Measles
shr05163  Human cytomegalovirus infection
shr05164  Influenza A
shr05165  Human papillomavirus infection
shr05166  Human T-cell leukemia virus 1 infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05168  Herpes simplex virus 1 infection
shr05169  Epstein-Barr virus infection
shr05170  Human immunodeficiency virus 1 infection
shr05171  Coronavirus disease - COVID-19
shr05200  Pathways in cancer
shr05203  Viral carcinogenesis
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05210  Colorectal cancer
shr05211  Renal cell carcinoma
shr05212  Pancreatic cancer
shr05213  Endometrial cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05218  Melanoma
shr05220  Chronic myeloid leukemia
shr05221  Acute myeloid leukemia
shr05222  Small cell lung cancer
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05230  Central carbon metabolism in cancer
shr05231  Choline metabolism in cancer
shr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
shr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100932099 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100932099 (PIK3CA)
   04014 Ras signaling pathway
    100932099 (PIK3CA)
   04015 Rap1 signaling pathway
    100932099 (PIK3CA)
   04370 VEGF signaling pathway
    100932099 (PIK3CA)
   04630 JAK-STAT signaling pathway
    100932099 (PIK3CA)
   04668 TNF signaling pathway
    100932099 (PIK3CA)
   04066 HIF-1 signaling pathway
    100932099 (PIK3CA)
   04068 FoxO signaling pathway
    100932099 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    100932099 (PIK3CA)
   04072 Phospholipase D signaling pathway
    100932099 (PIK3CA)
   04071 Sphingolipid signaling pathway
    100932099 (PIK3CA)
   04024 cAMP signaling pathway
    100932099 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    100932099 (PIK3CA)
   04152 AMPK signaling pathway
    100932099 (PIK3CA)
   04150 mTOR signaling pathway
    100932099 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100932099 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    100932099 (PIK3CA)
   04218 Cellular senescence
    100932099 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100932099 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    100932099 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100932099 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100932099 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    100932099 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    100932099 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    100932099 (PIK3CA)
   04660 T cell receptor signaling pathway
    100932099 (PIK3CA)
   04662 B cell receptor signaling pathway
    100932099 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    100932099 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    100932099 (PIK3CA)
   04670 Leukocyte transendothelial migration
    100932099 (PIK3CA)
   04062 Chemokine signaling pathway
    100932099 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100932099 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    100932099 (PIK3CA)
   04929 GnRH secretion
    100932099 (PIK3CA)
   04915 Estrogen signaling pathway
    100932099 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    100932099 (PIK3CA)
   04917 Prolactin signaling pathway
    100932099 (PIK3CA)
   04926 Relaxin signaling pathway
    100932099 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    100932099 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    100932099 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100932099 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100932099 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    100932099 (PIK3CA)
   04722 Neurotrophin signaling pathway
    100932099 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100932099 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    100932099 (PIK3CA)
   04380 Osteoclast differentiation
    100932099 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    100932099 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    100932099 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100932099 (PIK3CA)
   05206 MicroRNAs in cancer
    100932099 (PIK3CA)
   05205 Proteoglycans in cancer
    100932099 (PIK3CA)
   05203 Viral carcinogenesis
    100932099 (PIK3CA)
   05230 Central carbon metabolism in cancer
    100932099 (PIK3CA)
   05231 Choline metabolism in cancer
    100932099 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100932099 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100932099 (PIK3CA)
   05212 Pancreatic cancer
    100932099 (PIK3CA)
   05225 Hepatocellular carcinoma
    100932099 (PIK3CA)
   05226 Gastric cancer
    100932099 (PIK3CA)
   05214 Glioma
    100932099 (PIK3CA)
   05221 Acute myeloid leukemia
    100932099 (PIK3CA)
   05220 Chronic myeloid leukemia
    100932099 (PIK3CA)
   05218 Melanoma
    100932099 (PIK3CA)
   05211 Renal cell carcinoma
    100932099 (PIK3CA)
   05215 Prostate cancer
    100932099 (PIK3CA)
   05213 Endometrial cancer
    100932099 (PIK3CA)
   05224 Breast cancer
    100932099 (PIK3CA)
   05222 Small cell lung cancer
    100932099 (PIK3CA)
   05223 Non-small cell lung cancer
    100932099 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100932099 (PIK3CA)
   05017 Spinocerebellar ataxia
    100932099 (PIK3CA)
   05020 Prion disease
    100932099 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100932099 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100932099 (PIK3CA)
   04932 Non-alcoholic fatty liver disease
    100932099 (PIK3CA)
   04931 Insulin resistance
    100932099 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100932099 (PIK3CA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100932099 (PIK3CA)
   05135 Yersinia infection
    100932099 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    100932099 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100932099 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    100932099 (PIK3CA)
   05161 Hepatitis B
    100932099 (PIK3CA)
   05160 Hepatitis C
    100932099 (PIK3CA)
   05171 Coronavirus disease - COVID-19
    100932099 (PIK3CA)
   05164 Influenza A
    100932099 (PIK3CA)
   05162 Measles
    100932099 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    100932099 (PIK3CA)
   05163 Human cytomegalovirus infection
    100932099 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100932099 (PIK3CA)
   05169 Epstein-Barr virus infection
    100932099 (PIK3CA)
   05165 Human papillomavirus infection
    100932099 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100932099 (PIK3CA)
   05142 Chagas disease
    100932099 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100932099 (PIK3CA)
   01524 Platinum drug resistance
    100932099 (PIK3CA)
   01522 Endocrine resistance
    100932099 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:shr04131]
    100932099 (PIK3CA)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100932099 (PIK3CA)
Membrane trafficking [BR:shr04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100932099 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 Ribosomal_S15
Other DBs
NCBI-GeneID: 100932099
NCBI-ProteinID: XP_031813556
Ensembl: ENSSHAG00000016406
LinkDB
Position
3
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLVTIKHELFKEARKYPLHQ
LLQDETSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDVHAPHSRALYVYPPNVESSPELPKH
IYSKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEHVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYLLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYTQLPLD
TFTMPSYSRRISTATPYMNGEASTKSLWGVNSALRIRILCATYVNVNIRDIDKIYVRTGI
CHGGEPLCDNVNTQRVPCSNPRWNEWLMYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SNPVKFPDMSVIEEHANWTVSRELGFNYSHAGLSNRIARDNELRENDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVNIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRAFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDYMDALQGFISPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccaagaccatcatccggtgaattatggggcatccatttgatgcccccaagaatc
ttagtagaatgtctactacctaatggaatgatagtgactttagaatgcctccgtgaggct
acattagtaactattaaacatgagctatttaaagaagcaaggaaataccctcttcaccag
ctccttcaggatgaaacttcttacattttcgtaagtgttactcaagaagcagaaagagaa
gaattttttgatgaaacacggcgactttgtgacctgcggctttttcagccctttctgaaa
gtcatcgaacctgtaggaaaccgagaagaaaaaattctcaatcgagaaatcggttttgct
attggtatgcctgtttgtgaatttgacatggttaaagatccagaagtgcaagacttccga
agaaatattcttaatgtttgtaaagaagctgtggacctgagggatgtccatgcaccccat
agtagagcattatatgtttatcctccaaatgtagaatcttcaccagaattgccaaagcac
atatacagtaaattagataaagggcaaataatagtggtgatttgggtgatagtttcccca
aacaatgacaagcaaaagtacactttaaaaatcaatcacgactgtgtaccagaacatgtg
atcgctgaagcaatccggaaaaaaacacggagtatgttactatcatctgagcagctgaag
ctctgtgttttagagtatcagggcaaatatattttaaaagtgtgtggatgtgatgagtat
ttgctagaaaaatatcctcttagccaatataagtacataagaagctgtataatgcttggt
cggatgcccaatctgatgctgatggctaaagaaagtctttacacccagctaccactggat
acttttacaatgccatcttattccaggcgaatctctacagccacaccgtacatgaatgga
gaagcttcaaccaaatccctttggggcgtaaatagtgcactccgcataagaattctttgt
gcaacttatgtaaatgtaaatattcgagacattgacaagatctatgttagaacaggtatt
tgccatgggggtgagccattatgtgacaatgtgaatactcagagagtaccttgttccaat
cccaggtggaatgaatggctaatgtatgatatatacattcccgatcttccacgtgctgct
cgactttgcctttccatttgttctgttaaaggcaggaaaggagcaaaagaggaacattgc
ccattggcttggggaaatattaacctctttgattatacagacactctggtatcaggaaaa
atggctttgaatctgtggccagtacctcatggattagaagacttgctgaatcctattgga
gttactggatcaaatcccaataaggaaactccatgtttagagctggaatttgactggttt
agcaatcctgtaaagttcccagatatgtcagtaattgaagaacatgcaaattggactgta
tctcgagaactaggattcaactattcccatgctggactgagtaataggatagctcgagat
aatgaattgagagaaaatgacaaagaacagctccgggcgatttgtacacgagaccctctg
tctgagatcactgagcaagaaaaggacttcctgtggagtcataggcattattgtgtcaat
ataccagaaattctacctaaactacttctgtctgttaagtggaattctagagatgaagta
gcccagatgtattgcttggtaaaagattggcccccaatcaaaccagaacaggccatggaa
cttttggactgtaattatccagaccctatggttcgagcttttgctgttcgatgcttggag
aaatatttaactgatgacaaactttctcaatacttaattcaactggttcaggttctgaag
tatgaacagtatttggataacctgcttgtgagatttttactcaagaaagcactaacaaat
caaaggatagggcactttttcttttggcatttaaagtctgaaatgcataataaaactgtc
agccagagatttggtttgcttttggagtcatactgtcgagcatgtgggatgtatctaaag
catctgaatcggcaggtagaggccatggagaaactgatcaacctcaccgacattctcaaa
caggagaagaaggatgagacacaaaaggtacagatgaagttcttggttgagcaaatgaga
cgacctgattacatggatgctttacaaggctttatctctccccttaaccctgctcatcaa
ctaggaaatctcaggctcgaagagtgtaggattatgtcttccgcaaaaagaccactgtgg
ttgaattgggagaacccagacatcatgtcagagttactatttcagaacaatgagatcatc
tttaaaaatggggatgacttacggcaggatatgctaacccttcagatcattcggattatg
gaaaatatctggcaaaatcagggtcttgatcttcggatgttaccttatggttgtctatca
atcggggactgtgttggcctcattgaggtggtcagaaattcccacactatcatgcagatt
cagtgtaaagggggcctgaaaggggccttgcagttcaacagccatacgttacatcagtgg
ctcaaagacaagaataaaggagaaatatatgatgcagccattgatttgtttacacgttcc
tgtgctggatactgtgtggctaccttcattttgggaattggtgatcgacacaatagcaat
atcatggtgaaagatgatggacaactattccacatagactttggacactttttggatcac
aagaagaagaaatttggctataaacgagagcgtgtgcccttcgtcttgacgcaagatttc
ttaattgtgattagtaaaggagcccaagaatgtacaaagacaagagagtttgagaggttt
caggaaatgtgctataaggcttacttagctattcgacaacatgccaatctcttcatcaat
ctcttctccatgatgcttggctccggaatgcccgaacttcagtcttttgacgacatcgcc
tatattcgaaagaccctggccttggataagactgagcaggaggctttggagtatttcatg
aagcagatgaatgatgctcatcatgggggctggacaaccaaaatggattggattttccat
acgataaagcagcacgctttgaactga

KEGG   Sarcophilus harrisii (Tasmanian devil): 100935230
Entry
100935230         CDS       T02286                                 

Gene name
PIK3R3
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr01522  Endocrine resistance
shr01524  Platinum drug resistance
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04015  Rap1 signaling pathway
shr04024  cAMP signaling pathway
shr04062  Chemokine signaling pathway
shr04066  HIF-1 signaling pathway
shr04068  FoxO signaling pathway
shr04070  Phosphatidylinositol signaling system
shr04071  Sphingolipid signaling pathway
shr04072  Phospholipase D signaling pathway
shr04140  Autophagy - animal
shr04150  mTOR signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04152  AMPK signaling pathway
shr04210  Apoptosis
shr04211  Longevity regulating pathway
shr04213  Longevity regulating pathway - multiple species
shr04218  Cellular senescence
shr04360  Axon guidance
shr04370  VEGF signaling pathway
shr04380  Osteoclast differentiation
shr04510  Focal adhesion
shr04550  Signaling pathways regulating pluripotency of stem cells
shr04611  Platelet activation
shr04620  Toll-like receptor signaling pathway
shr04625  C-type lectin receptor signaling pathway
shr04630  JAK-STAT signaling pathway
shr04650  Natural killer cell mediated cytotoxicity
shr04660  T cell receptor signaling pathway
shr04662  B cell receptor signaling pathway
shr04664  Fc epsilon RI signaling pathway
shr04666  Fc gamma R-mediated phagocytosis
shr04668  TNF signaling pathway
shr04670  Leukocyte transendothelial migration
shr04722  Neurotrophin signaling pathway
shr04725  Cholinergic synapse
shr04750  Inflammatory mediator regulation of TRP channels
shr04810  Regulation of actin cytoskeleton
shr04910  Insulin signaling pathway
shr04914  Progesterone-mediated oocyte maturation
shr04915  Estrogen signaling pathway
shr04917  Prolactin signaling pathway
shr04919  Thyroid hormone signaling pathway
shr04923  Regulation of lipolysis in adipocytes
shr04926  Relaxin signaling pathway
shr04929  GnRH secretion
shr04930  Type II diabetes mellitus
shr04931  Insulin resistance
shr04932  Non-alcoholic fatty liver disease
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr04935  Growth hormone synthesis, secretion and action
shr04960  Aldosterone-regulated sodium reabsorption
shr04973  Carbohydrate digestion and absorption
shr05010  Alzheimer disease
shr05017  Spinocerebellar ataxia
shr05020  Prion disease
shr05100  Bacterial invasion of epithelial cells
shr05135  Yersinia infection
shr05142  Chagas disease
shr05146  Amoebiasis
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05162  Measles
shr05163  Human cytomegalovirus infection
shr05164  Influenza A
shr05165  Human papillomavirus infection
shr05166  Human T-cell leukemia virus 1 infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05168  Herpes simplex virus 1 infection
shr05169  Epstein-Barr virus infection
shr05170  Human immunodeficiency virus 1 infection
shr05171  Coronavirus disease - COVID-19
shr05200  Pathways in cancer
shr05203  Viral carcinogenesis
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05210  Colorectal cancer
shr05211  Renal cell carcinoma
shr05212  Pancreatic cancer
shr05213  Endometrial cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05218  Melanoma
shr05220  Chronic myeloid leukemia
shr05221  Acute myeloid leukemia
shr05222  Small cell lung cancer
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05230  Central carbon metabolism in cancer
shr05231  Choline metabolism in cancer
shr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
shr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100935230 (PIK3R3)
   04014 Ras signaling pathway
    100935230 (PIK3R3)
   04015 Rap1 signaling pathway
    100935230 (PIK3R3)
   04370 VEGF signaling pathway
    100935230 (PIK3R3)
   04630 JAK-STAT signaling pathway
    100935230 (PIK3R3)
   04668 TNF signaling pathway
    100935230 (PIK3R3)
   04066 HIF-1 signaling pathway
    100935230 (PIK3R3)
   04068 FoxO signaling pathway
    100935230 (PIK3R3)
   04070 Phosphatidylinositol signaling system
    100935230 (PIK3R3)
   04072 Phospholipase D signaling pathway
    100935230 (PIK3R3)
   04071 Sphingolipid signaling pathway
    100935230 (PIK3R3)
   04024 cAMP signaling pathway
    100935230 (PIK3R3)
   04151 PI3K-Akt signaling pathway
    100935230 (PIK3R3)
   04152 AMPK signaling pathway
    100935230 (PIK3R3)
   04150 mTOR signaling pathway
    100935230 (PIK3R3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100935230 (PIK3R3)
  09143 Cell growth and death
   04210 Apoptosis
    100935230 (PIK3R3)
   04218 Cellular senescence
    100935230 (PIK3R3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100935230 (PIK3R3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100935230 (PIK3R3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100935230 (PIK3R3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100935230 (PIK3R3)
   04620 Toll-like receptor signaling pathway
    100935230 (PIK3R3)
   04625 C-type lectin receptor signaling pathway
    100935230 (PIK3R3)
   04650 Natural killer cell mediated cytotoxicity
    100935230 (PIK3R3)
   04660 T cell receptor signaling pathway
    100935230 (PIK3R3)
   04662 B cell receptor signaling pathway
    100935230 (PIK3R3)
   04664 Fc epsilon RI signaling pathway
    100935230 (PIK3R3)
   04666 Fc gamma R-mediated phagocytosis
    100935230 (PIK3R3)
   04670 Leukocyte transendothelial migration
    100935230 (PIK3R3)
   04062 Chemokine signaling pathway
    100935230 (PIK3R3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100935230 (PIK3R3)
   04923 Regulation of lipolysis in adipocytes
    100935230 (PIK3R3)
   04929 GnRH secretion
    100935230 (PIK3R3)
   04915 Estrogen signaling pathway
    100935230 (PIK3R3)
   04914 Progesterone-mediated oocyte maturation
    100935230 (PIK3R3)
   04917 Prolactin signaling pathway
    100935230 (PIK3R3)
   04926 Relaxin signaling pathway
    100935230 (PIK3R3)
   04935 Growth hormone synthesis, secretion and action
    100935230 (PIK3R3)
   04919 Thyroid hormone signaling pathway
    100935230 (PIK3R3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100935230 (PIK3R3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100935230 (PIK3R3)
  09156 Nervous system
   04725 Cholinergic synapse
    100935230 (PIK3R3)
   04722 Neurotrophin signaling pathway
    100935230 (PIK3R3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100935230 (PIK3R3)
  09158 Development and regeneration
   04360 Axon guidance
    100935230 (PIK3R3)
   04380 Osteoclast differentiation
    100935230 (PIK3R3)
  09149 Aging
   04211 Longevity regulating pathway
    100935230 (PIK3R3)
   04213 Longevity regulating pathway - multiple species
    100935230 (PIK3R3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100935230 (PIK3R3)
   05206 MicroRNAs in cancer
    100935230 (PIK3R3)
   05205 Proteoglycans in cancer
    100935230 (PIK3R3)
   05203 Viral carcinogenesis
    100935230 (PIK3R3)
   05230 Central carbon metabolism in cancer
    100935230 (PIK3R3)
   05231 Choline metabolism in cancer
    100935230 (PIK3R3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100935230 (PIK3R3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100935230 (PIK3R3)
   05212 Pancreatic cancer
    100935230 (PIK3R3)
   05225 Hepatocellular carcinoma
    100935230 (PIK3R3)
   05226 Gastric cancer
    100935230 (PIK3R3)
   05214 Glioma
    100935230 (PIK3R3)
   05221 Acute myeloid leukemia
    100935230 (PIK3R3)
   05220 Chronic myeloid leukemia
    100935230 (PIK3R3)
   05218 Melanoma
    100935230 (PIK3R3)
   05211 Renal cell carcinoma
    100935230 (PIK3R3)
   05215 Prostate cancer
    100935230 (PIK3R3)
   05213 Endometrial cancer
    100935230 (PIK3R3)
   05224 Breast cancer
    100935230 (PIK3R3)
   05222 Small cell lung cancer
    100935230 (PIK3R3)
   05223 Non-small cell lung cancer
    100935230 (PIK3R3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100935230 (PIK3R3)
   05017 Spinocerebellar ataxia
    100935230 (PIK3R3)
   05020 Prion disease
    100935230 (PIK3R3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100935230 (PIK3R3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100935230 (PIK3R3)
   04932 Non-alcoholic fatty liver disease
    100935230 (PIK3R3)
   04931 Insulin resistance
    100935230 (PIK3R3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100935230 (PIK3R3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100935230 (PIK3R3)
   05100 Bacterial invasion of epithelial cells
    100935230 (PIK3R3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100935230 (PIK3R3)
   05170 Human immunodeficiency virus 1 infection
    100935230 (PIK3R3)
   05161 Hepatitis B
    100935230 (PIK3R3)
   05160 Hepatitis C
    100935230 (PIK3R3)
   05171 Coronavirus disease - COVID-19
    100935230 (PIK3R3)
   05164 Influenza A
    100935230 (PIK3R3)
   05162 Measles
    100935230 (PIK3R3)
   05168 Herpes simplex virus 1 infection
    100935230 (PIK3R3)
   05163 Human cytomegalovirus infection
    100935230 (PIK3R3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100935230 (PIK3R3)
   05169 Epstein-Barr virus infection
    100935230 (PIK3R3)
   05165 Human papillomavirus infection
    100935230 (PIK3R3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100935230 (PIK3R3)
   05142 Chagas disease
    100935230 (PIK3R3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100935230 (PIK3R3)
   01524 Platinum drug resistance
    100935230 (PIK3R3)
   01522 Endocrine resistance
    100935230 (PIK3R3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:shr04131]
    100935230 (PIK3R3)
Membrane trafficking [BR:shr04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100935230 (PIK3R3)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 DUF5638
Other DBs
NCBI-GeneID: 100935230
NCBI-ProteinID: XP_031825058
LinkDB
Position
4
AA seq 476 aa
MYTPPWGMEREDGGEGEGEGGEGGEGEDWRDVTMPYSTELIFYIEMDPPALPPKPPKSLT
QAGANGLKDSSGFSLPDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKVQGDYTLTLR
KGGNNKLIKIYHRDGKYGFSDPLTFSSVVELINHYRHESLAQYNPKLDVKLMYPISRYQQ
DQLVKEDNIDAVGTKLQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKI
FEEQCATQERQSKDYIERFRREGNEKEIERIMMNYEKLKSRLGEIHDSKMRLEQDLKKQA
LDNRETDKKMNSIKPDLIQLRKIRDQYLVWLSHKGVRQKRLNDWLGIKNDHIDETYFMNE
EDENLPHYDEKTWFVGDLNRLQAEDLLHGKPDGAFLIRESSKKGCYACSVVADGDVKHCV
IYSTARGYGFAEPYNLYGSLKELVLHYQHTSLVQHNDSLNVRLAHPVYAQLPSHCR
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgtacacgccgccgtggggcatggagcgcgaggacggcggggaaggagaaggcgagggc
ggcgagggcggcgaaggcgaggactggagggacgtgaccatgccctactccactgagctc
atcttctacatcgagatggaccccccagctcttccgccaaagccgcccaaatccttgact
caagccggtgccaacggcctgaaggacagttcagggttttccctccctgacgcagagtgg
tactggggagacatctcaagggaagaggtcaatgataaactccgggacatgcccgacgga
accttcctggtgcgagacgcatccaccaaggtgcagggagactacacgcttactctgcgg
aagggaggcaataataaattgattaagatttaccatcgggatggcaaatacggcttctca
gacccgctgaccttcagctctgtggtggagctgatcaatcactaccgccatgagtctctg
gcccagtacaatcccaagctcgacgtgaagctgatgtaccccatctccaggtaccagcag
gatcagctggtgaaagaagacaacatcgatgccgttggcacaaagctgcaggaataccac
tctcagtaccaagagaagagcaaagagtatgatcggctgtatgaggagtataccaggacc
tcacaggaaattcaaatgaagaggacggcgatcgaagcttttaacgagacaattaagatc
tttgaggagcagtgtgcaacccaggagcgccagagcaaagactacattgaacgctttcgg
cgagaggggaacgaaaaggagattgagcggataatgatgaattatgagaagctgaaatcg
cgtctgggtgaaattcacgatagcaaaatgcgtctggagcaggacctgaagaagcaggcg
ctggataaccgggagacggacaagaagatgaacagcatcaagccggacctgattcagctg
cgcaagatccgcgaccagtacctagtatggctcagccacaaaggagtccgacagaaacga
ctcaacgactggctgggaatcaaaaatgaccacatcgatgagacctattttatgaatgag
gaagatgaaaatctgccacactatgacgagaaaacgtggtttgttggggatctcaaccgg
ctccaggcggaagacctgctccacgggaagcccgacggagccttcttaattcgcgagagc
agcaagaagggctgctacgcctgctccgtggtggccgacggggacgtgaagcactgcgtg
atctacagcacggcgcggggctacggcttcgccgagccctacaacctgtatggcagcctg
aaggagctggtcctgcactaccagcacacgtccctcgtccagcacaacgactccctcaac
gtccggctggcccaccccgtctacgcacagctgccctcccactgcagatag

KEGG   Sarcophilus harrisii (Tasmanian devil): 105749979
Entry
105749979         CDS       T02286                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00562  Inositol phosphate metabolism
shr01100  Metabolic pathways
shr01521  EGFR tyrosine kinase inhibitor resistance
shr01522  Endocrine resistance
shr01524  Platinum drug resistance
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04015  Rap1 signaling pathway
shr04024  cAMP signaling pathway
shr04062  Chemokine signaling pathway
shr04066  HIF-1 signaling pathway
shr04068  FoxO signaling pathway
shr04070  Phosphatidylinositol signaling system
shr04071  Sphingolipid signaling pathway
shr04072  Phospholipase D signaling pathway
shr04140  Autophagy - animal
shr04150  mTOR signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04152  AMPK signaling pathway
shr04210  Apoptosis
shr04211  Longevity regulating pathway
shr04213  Longevity regulating pathway - multiple species
shr04218  Cellular senescence
shr04360  Axon guidance
shr04370  VEGF signaling pathway
shr04380  Osteoclast differentiation
shr04510  Focal adhesion
shr04550  Signaling pathways regulating pluripotency of stem cells
shr04611  Platelet activation
shr04620  Toll-like receptor signaling pathway
shr04625  C-type lectin receptor signaling pathway
shr04630  JAK-STAT signaling pathway
shr04650  Natural killer cell mediated cytotoxicity
shr04660  T cell receptor signaling pathway
shr04662  B cell receptor signaling pathway
shr04664  Fc epsilon RI signaling pathway
shr04666  Fc gamma R-mediated phagocytosis
shr04668  TNF signaling pathway
shr04670  Leukocyte transendothelial migration
shr04722  Neurotrophin signaling pathway
shr04725  Cholinergic synapse
shr04750  Inflammatory mediator regulation of TRP channels
shr04810  Regulation of actin cytoskeleton
shr04910  Insulin signaling pathway
shr04914  Progesterone-mediated oocyte maturation
shr04915  Estrogen signaling pathway
shr04917  Prolactin signaling pathway
shr04919  Thyroid hormone signaling pathway
shr04923  Regulation of lipolysis in adipocytes
shr04926  Relaxin signaling pathway
shr04929  GnRH secretion
shr04930  Type II diabetes mellitus
shr04931  Insulin resistance
shr04932  Non-alcoholic fatty liver disease
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr04935  Growth hormone synthesis, secretion and action
shr04960  Aldosterone-regulated sodium reabsorption
shr04973  Carbohydrate digestion and absorption
shr05010  Alzheimer disease
shr05017  Spinocerebellar ataxia
shr05020  Prion disease
shr05100  Bacterial invasion of epithelial cells
shr05132  Salmonella infection
shr05135  Yersinia infection
shr05142  Chagas disease
shr05146  Amoebiasis
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05162  Measles
shr05163  Human cytomegalovirus infection
shr05164  Influenza A
shr05165  Human papillomavirus infection
shr05166  Human T-cell leukemia virus 1 infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05168  Herpes simplex virus 1 infection
shr05169  Epstein-Barr virus infection
shr05170  Human immunodeficiency virus 1 infection
shr05171  Coronavirus disease - COVID-19
shr05200  Pathways in cancer
shr05203  Viral carcinogenesis
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05210  Colorectal cancer
shr05211  Renal cell carcinoma
shr05212  Pancreatic cancer
shr05213  Endometrial cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05218  Melanoma
shr05220  Chronic myeloid leukemia
shr05221  Acute myeloid leukemia
shr05222  Small cell lung cancer
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05230  Central carbon metabolism in cancer
shr05231  Choline metabolism in cancer
shr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
shr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    105749979 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105749979 (PIK3CD)
   04014 Ras signaling pathway
    105749979 (PIK3CD)
   04015 Rap1 signaling pathway
    105749979 (PIK3CD)
   04370 VEGF signaling pathway
    105749979 (PIK3CD)
   04630 JAK-STAT signaling pathway
    105749979 (PIK3CD)
   04668 TNF signaling pathway
    105749979 (PIK3CD)
   04066 HIF-1 signaling pathway
    105749979 (PIK3CD)
   04068 FoxO signaling pathway
    105749979 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    105749979 (PIK3CD)
   04072 Phospholipase D signaling pathway
    105749979 (PIK3CD)
   04071 Sphingolipid signaling pathway
    105749979 (PIK3CD)
   04024 cAMP signaling pathway
    105749979 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    105749979 (PIK3CD)
   04152 AMPK signaling pathway
    105749979 (PIK3CD)
   04150 mTOR signaling pathway
    105749979 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105749979 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    105749979 (PIK3CD)
   04218 Cellular senescence
    105749979 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105749979 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    105749979 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105749979 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    105749979 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    105749979 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    105749979 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    105749979 (PIK3CD)
   04660 T cell receptor signaling pathway
    105749979 (PIK3CD)
   04662 B cell receptor signaling pathway
    105749979 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    105749979 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    105749979 (PIK3CD)
   04670 Leukocyte transendothelial migration
    105749979 (PIK3CD)
   04062 Chemokine signaling pathway
    105749979 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105749979 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    105749979 (PIK3CD)
   04929 GnRH secretion
    105749979 (PIK3CD)
   04915 Estrogen signaling pathway
    105749979 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    105749979 (PIK3CD)
   04917 Prolactin signaling pathway
    105749979 (PIK3CD)
   04926 Relaxin signaling pathway
    105749979 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    105749979 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    105749979 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    105749979 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    105749979 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    105749979 (PIK3CD)
   04722 Neurotrophin signaling pathway
    105749979 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    105749979 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    105749979 (PIK3CD)
   04380 Osteoclast differentiation
    105749979 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    105749979 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    105749979 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105749979 (PIK3CD)
   05206 MicroRNAs in cancer
    105749979 (PIK3CD)
   05205 Proteoglycans in cancer
    105749979 (PIK3CD)
   05203 Viral carcinogenesis
    105749979 (PIK3CD)
   05230 Central carbon metabolism in cancer
    105749979 (PIK3CD)
   05231 Choline metabolism in cancer
    105749979 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105749979 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105749979 (PIK3CD)
   05212 Pancreatic cancer
    105749979 (PIK3CD)
   05225 Hepatocellular carcinoma
    105749979 (PIK3CD)
   05226 Gastric cancer
    105749979 (PIK3CD)
   05214 Glioma
    105749979 (PIK3CD)
   05221 Acute myeloid leukemia
    105749979 (PIK3CD)
   05220 Chronic myeloid leukemia
    105749979 (PIK3CD)
   05218 Melanoma
    105749979 (PIK3CD)
   05211 Renal cell carcinoma
    105749979 (PIK3CD)
   05215 Prostate cancer
    105749979 (PIK3CD)
   05213 Endometrial cancer
    105749979 (PIK3CD)
   05224 Breast cancer
    105749979 (PIK3CD)
   05222 Small cell lung cancer
    105749979 (PIK3CD)
   05223 Non-small cell lung cancer
    105749979 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105749979 (PIK3CD)
   05017 Spinocerebellar ataxia
    105749979 (PIK3CD)
   05020 Prion disease
    105749979 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    105749979 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    105749979 (PIK3CD)
   04932 Non-alcoholic fatty liver disease
    105749979 (PIK3CD)
   04931 Insulin resistance
    105749979 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    105749979 (PIK3CD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105749979 (PIK3CD)
   05135 Yersinia infection
    105749979 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    105749979 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105749979 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    105749979 (PIK3CD)
   05161 Hepatitis B
    105749979 (PIK3CD)
   05160 Hepatitis C
    105749979 (PIK3CD)
   05171 Coronavirus disease - COVID-19
    105749979 (PIK3CD)
   05164 Influenza A
    105749979 (PIK3CD)
   05162 Measles
    105749979 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    105749979 (PIK3CD)
   05163 Human cytomegalovirus infection
    105749979 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105749979 (PIK3CD)
   05169 Epstein-Barr virus infection
    105749979 (PIK3CD)
   05165 Human papillomavirus infection
    105749979 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    105749979 (PIK3CD)
   05142 Chagas disease
    105749979 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105749979 (PIK3CD)
   01524 Platinum drug resistance
    105749979 (PIK3CD)
   01522 Endocrine resistance
    105749979 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:shr04131]
    105749979 (PIK3CD)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     105749979 (PIK3CD)
Membrane trafficking [BR:shr04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    105749979 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3K_p85B PI3Ka PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 105749979
NCBI-ProteinID: XP_031818768
LinkDB
Position
3
AA seq 1034 aa
MPPGVDCPMEFWSKEENQIVEVDFLLPTGVYLNFPVSRNANLSSIKEVLWHNAQSEPLFH
MLSDPEAYVFTCINQTAEQQELEDEQRRLCDIQPFLPVLRLVARQGDRVKKLINSQISLL
IGKGLHEFDSLGDPEVNDFRTKMGQFCEEAAAHRQQLGWEAWMHYNFPLQLEPSARGLGA
GALRGPSRTLFVNVKFEGNEESFTFQVSPNDFPLALMACALKKRVTVFRQPALERPEDYT
LKVNGKYEYLYGSYPLYQFQYICRCLHNGQTPHLTMVHCSSILAMRDEQSNFPAQTPKLR
TKPPPIPMKKPSSVSLWALEQPFCIELIQGSKVNADERMKLVVLAGLFHGNEMLCKTVSS
SEVTVCSEPVWKQRLEFDINVCDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGERCLYMWSSVPDEKGELLNPMGTVWSNPNTESAAALVICIPEVAP
HPVYYPTMEKILELGKNGEHGRFTEDELQQLREILERKVAGELYEHEKDLVWKMRHEIQE
QFPEALARLLLVTKWNKHEDVAQMLFLLSSWPELPVLSALELLDFSFPDRHVGSFAIQSL
RKLTDDELFQYLLQLVQVLARVPPDRVTVPAGRPHRKIGRSSLSSEMHVPSVALRFGLIM
EAYCRGSNHHMKALMKQGEALNKMKALNDFVRVSSQRTTKPQTKELMHVCLRQEIYMEAL
SNLQSPLNPSTLLSEVCVEQCTFMDSKRSRGSQAAGEAAGSCSPGIIFKNGDDLRQDMLT
LQMIQLMDVLWKQEGLDLRMTPYGCLSMGDRTGLIEVVSHSDTIANIQLNKSNMAATAAF
NKDALLNWLKSKNPGEALERAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHI
DFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNNEKFERFRSYCERAYTILRRH
GLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTDEEALKHFRVKFNEALRESWKTK
VNWLAHNVSKDNRQ
NT seq 3105 nt   +upstreamnt  +downstreamnt
atgccccctggagtcgactgtcctatggaattctggtccaaggaagagaaccagatcgtg
gaggtagacttcttgctgcccacgggggtctacctgaacttccccgtctctcgaaatgcc
aacctcagcagcatcaaagaggttctctggcacaatgcccagagcgagcccctgttccac
atgctcagcgaccccgaggcctacgtcttcacctgcatcaaccagacggctgagcagcag
gagctggaggacgagcagcggcggctctgcgacatccagcccttcctgcccgtgctgcgg
ctcgtggcccgccagggcgaccgcgtgaaaaagctcatcaactcccagatcagcctgctc
atcggcaaaggtctgcacgagtttgactccctgggggaccccgaggtcaatgacttccgc
accaagatgggccagttctgcgaggaggcggcggcccaccggcagcagctgggctgggag
gcctggatgcattacaacttccccttgcagctggagccctcagcccggggcctgggggcc
ggggcgctgcgcggccccagcaggaccctctttgtcaatgtcaagtttgagggcaacgag
gagagcttcaccttccaggtgtcccccaacgactttcccctggctctgatggcctgtgcc
ctcaagaagagggtcaccgtgttccggcagccggccctggagcggcctgaggactacacg
ctgaaggtcaacggcaagtacgagtacctgtatggcagctaccccctctaccagttccag
tatatctgcagatgcctccacaacgggcagacccctcacctcaccatggtccactgctcc
tccatcctcgccatgcgggacgagcagagcaacttccctgcgcagacccccaagctccgc
accaagccgcccccaattcctatgaagaagccatcctcggtgtccctgtgggctctagag
cagcccttctgcatcgagctgattcagggcagcaaggtgaacgccgatgagaggatgaag
cttgtggtcctggccggcctcttccatgggaacgagatgctgtgcaagacggtgtccagc
tccgaggtgaccgtgtgctcagagcccgtgtggaagcagcgtctcgagtttgatatcaac
gtctgcgacctgccgcgcatggcgcgcctctgctttgcgctctacgccgtcattgagaag
gccaagaaggcgcgctccaccaagaagaagtccaagaaggcggactgccctattgcttgg
gccaacctcatgctgtttgactacaaggaccagctgaagacgggcgagcgctgcctgtac
atgtggtcctccgtcccggatgagaaaggggagctgctgaaccccatgggcaccgtgtgg
agcaaccccaacaccgagagcgcggctgccctggtgatctgcatccccgaggtcgctccg
caccccgtgtactaccccaccatggagaagatcttggagctggggaaaaacggggagcac
ggacgcttcactgaggacgagctgcagcagctgcgggagatcctggagcgcaaggtggca
ggtgagctctatgagcacgagaaggacctggtgtggaagatgcgccacgagatccaggag
cagttccccgaggccctggccaggctcctgctggtcaccaagtggaacaagcatgaggat
gttgcccagatgctcttcctgctcagctcctggcctgagctgccggtgctgagtgccctg
gagctgctggacttcagcttcccggaccgccacgtgggctccttcgccatccagtccctg
aggaaactgacggacgacgagctctttcagtacctgctgcagctggtccaggtgctggca
cgagtcccacctgaccgcgtgaccgttcctgcgggccggccccaccgcaagatcggccgc
tcttccctcagctccgagatgcacgtcccctccgtggccctgcgcttcggcctcatcatg
gaggcctactgccgcggcagcaaccaccacatgaaggcgctgatgaagcagggggaggcc
ctgaacaaaatgaaggccctgaatgacttcgtcagagtgagctcccagaggaccaccaag
ccgcagaccaaggagctgatgcacgtgtgtttgaggcaggagatctacatggaggccctc
tcgaacctgcagtctcccctgaaccccagcaccttactgtcggaagtctgcgtggagcag
tgcaccttcatggactccaagagaagccgtggatcgcaggcagcaggggaggcggcggga
agctgcagcccgggcatcatctttaagaacggcgatgatctccgccaggacatgctgact
ctgcagatgatccagctgatggacgtgctgtggaagcaggaggggctggacctgaggatg
accccctacggctgcctctccatgggggaccggacggggctcatcgaggtggtgtcgcac
tcggacaccatcgccaacatccagctcaacaaaagcaacatggccgccaccgccgctttc
aacaaagacgccctgctcaactggctcaagtccaagaaccccggggaagccttggagcgg
gccatcgaggagttcacgctctcctgcgcgggctactgcgtggccacctacgtgctgggc
atcggggaccggcacagcgacaacatcatgatccgggagagcgggcagctcttccatatc
gattttggccactttttgggcaatttcaaaaccaaatttggaatcaaccgcgagcgagtc
ccgttcatcctgacgtacgattttgtccacgtgatccaacagggaaagaccaacaacaac
gagaagtttgagaggttccgcagctactgtgaaagggcctacaccatcctgcgccgccac
gggctcctgttccttcatctctttgcactgatgcgggcagccggcctgcctgagctcagc
tgctccaaagacatccagtatctcaaggactcgctggccttggggaaaacagacgaagag
gccctgaagcacttccgagtgaagtttaacgaggcccttcgagagagctggaaaaccaaa
gtgaactggctggcccacaacgtgtccaaagacaacaggcagtag

DBGET integrated database retrieval system