KEGG   Sarcophilus harrisii (Tasmanian devil): 100926503
Entry
100926503         CDS       T02286                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04010  MAPK signaling pathway
shr04020  Calcium signaling pathway
shr04022  cGMP-PKG signaling pathway
shr04024  cAMP signaling pathway
shr04260  Cardiac muscle contraction
shr04261  Adrenergic signaling in cardiomyocytes
shr04270  Vascular smooth muscle contraction
shr04713  Circadian entrainment
shr04720  Long-term potentiation
shr04723  Retrograde endocannabinoid signaling
shr04724  Glutamatergic synapse
shr04725  Cholinergic synapse
shr04726  Serotonergic synapse
shr04727  GABAergic synapse
shr04728  Dopaminergic synapse
shr04742  Taste transduction
shr04911  Insulin secretion
shr04912  GnRH signaling pathway
shr04921  Oxytocin signaling pathway
shr04924  Renin secretion
shr04925  Aldosterone synthesis and secretion
shr04927  Cortisol synthesis and secretion
shr04929  GnRH secretion
shr04930  Type II diabetes mellitus
shr04934  Cushing syndrome
shr04935  Growth hormone synthesis, secretion and action
shr05010  Alzheimer disease
shr05020  Prion disease
shr05022  Pathways of neurodegeneration - multiple diseases
shr05031  Amphetamine addiction
shr05410  Hypertrophic cardiomyopathy
shr05412  Arrhythmogenic right ventricular cardiomyopathy
shr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100926503
   04020 Calcium signaling pathway
    100926503
   04024 cAMP signaling pathway
    100926503
   04022 cGMP-PKG signaling pathway
    100926503
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100926503
   04929 GnRH secretion
    100926503
   04912 GnRH signaling pathway
    100926503
   04921 Oxytocin signaling pathway
    100926503
   04935 Growth hormone synthesis, secretion and action
    100926503
   04924 Renin secretion
    100926503
   04925 Aldosterone synthesis and secretion
    100926503
   04927 Cortisol synthesis and secretion
    100926503
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100926503
   04261 Adrenergic signaling in cardiomyocytes
    100926503
   04270 Vascular smooth muscle contraction
    100926503
  09156 Nervous system
   04724 Glutamatergic synapse
    100926503
   04727 GABAergic synapse
    100926503
   04725 Cholinergic synapse
    100926503
   04728 Dopaminergic synapse
    100926503
   04726 Serotonergic synapse
    100926503
   04720 Long-term potentiation
    100926503
   04723 Retrograde endocannabinoid signaling
    100926503
  09157 Sensory system
   04742 Taste transduction
    100926503
  09159 Environmental adaptation
   04713 Circadian entrainment
    100926503
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100926503
   05020 Prion disease
    100926503
   05022 Pathways of neurodegeneration - multiple diseases
    100926503
  09165 Substance dependence
   05031 Amphetamine addiction
    100926503
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100926503
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100926503
   05414 Dilated cardiomyopathy
    100926503
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100926503
   04934 Cushing syndrome
    100926503
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:shr04040]
    100926503
Ion channels [BR:shr04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100926503
SSDB
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH PKD_channel DUF4834
Other DBs
NCBI-GeneID: 100926503
NCBI-ProteinID: XP_031793652
Ensembl: ENSSHAG00000015182
LinkDB
Position
5
AA seq 1898 aa
MVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGLTDAPVEDDPSPCALDTGHGR
QCQNGTICKAGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIY
FVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQA
EDIDPENEDEGMDEEKPRNRSTPAGMIDKKKGKFSWFSHSTETHVSMPTSETESVNTENV
AGGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTL
TIASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGG
ILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLF
LFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAY
GGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLA
RTASPEKKQEVEKPAVEETKEEKIELKSITADGESPPSTKINVDDLQPNENEEKGSYPNP
EAGGEEEEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFGHNNRFRLQCHRIVNNN
VFTNLILFFILLSSISLAAEDPVRHNSFRNQILFHFDIVFTTIFTIEIALKMTAYGAFLH
KGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQ
CVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCTDSSKQTEAECKGNYITYKDGE
VDHPIIQPRSWENSKFDFDNVLTAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRV
EISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLR
RYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTG
LFTVEMILKLIAFKPKHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSPSMNAEEN
SRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQ
VFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACLPGKKCAPESESSNS
TESETYCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRI
WAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNA
TLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYA
TFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELD
KAMKEAVSAASEDDIFRRAGGLFGNHVTYYQSDGRSSFPQTFTTQRPLHINKAGNSQGDT
ESPSHEKLVDSTFTPSSYSSSGSNANINNANNTALGRFPCPTGYPSTVSTVEGHGTPLSP
AIRVHETAWKLSSRRYHSRDSRIAMMCPEEAAPTKSFEGNVNEDTEYCSEPSLISTEMLS
YQDDENRQLTPPEDKTRQSMKRGFLHSSSLGRRASFHLECLKRQKNQGGDISQKTVLPLH
LVHHQALAVTGLSPLLQRSHSPSTTFPRPSATPPATPHGQAWPQQPIPTLWLEGAESNEK
LNSSFPSIHCSSWYAENASCGASRGGASRRARPVSLTVPSQSGAAGRQFHGSASSLVEAV
LISEGLGQFAQDPKFIEVTTQELADACDMTIEEMENAADNILSGSSKQSPNGNLLPFINC
RDAGQDQAGGEEEEGMPNPECRKSQEELQDSRVYISSL
NT seq 5697 nt   +upstreamnt  +downstreamnt
atggtcccactgctgcatattgccttgcttgtgttatttgtcataatcatctatgccatc
attggattggaactcttcatggggaagatgcacaaaacttgctacaaccaggagggttta
acagatgccccagtagaagatgacccttctccctgtgcccttgacacgggacatggacga
cagtgccagaatggcaccatatgtaaagcagggtgggatggacccaaacacggcatcacc
aactttgacaatttcgccttcgccatgttaactgtgttccagtgcattacaatggagggc
tggacggatgtgctgtactgggtcaatgatgccgtaggaagggactggccctggatctat
tttgttacactaatcatcatagggtcattttttgttcttaacttggttctcggtgtcctt
agcggagaattttccaaagagagagagaaggcaaaggctagaggagacttccaaaagctg
cgagagaagcagcagctggaagaggacctcaaaggctacttggactggatcactcaagct
gaagatattgaccctgagaatgaagatgaaggaatggatgaggagaagcccagaaataga
agcactccggctggcatgattgataagaagaaagggaagttttcttggtttagtcactcc
acagaaacccatgtgagcatgcccacaagtgagacagagtccgtcaacactgaaaacgtg
gctggaggcgacatcgagggagagaactgtggggcgagactggcgcaccgaatctccaaa
tcaaagttcagccgttactggcgcagatggaaccggttctgcagaaggaagtgccgagct
gctgtcaaatccaatgttttctattggcttgttattttccttgtatttctcaacacactc
accattgcctcagagcactacaaccagccccactggctcacggaagtccaagacactgcc
aacaaggccctgctggctcttttcactgcagagatgctgttgaagatgtacagccttggt
ctccaggcctattttgtgtctctgttcaaccgctttgactgcttcattgtgtgtggagga
atcctggagaccatcctggtagagaccaagatcatgtcccccttgggaatctcagtgttg
agatgtgtccggctgctgaggatatttaaaattacaaggtattggaattccttgagcaac
ctggtagcatcattactgaattcagtgagatcaattgcttcactcctgctgctccttttc
ctcttcatcatcatcttctctctcctggggatgcagctctttggtggaaagttcaacttt
gatgagatgcagacccggaggagtacatttgataatttcccccagtctcttctcactgtg
tttcagatcctgaccggggaggactggaattcggtgatgtatgatgggatcatggcttat
ggagggccctcttttccagggatgttagtctgtatttacttcatcatccttttcatctgt
ggaaactacatcttactgaatgtattcttggccattgctgtggacaatctggctgatgct
gagagtctcacatctgctcagaaagaagaggaggaggaaaaagagaggaagaagctagcc
aggactgccagccctgaaaagaagcaagaggtggagaaaccagctgtggaggaaaccaag
gaggagaaaattgagctaaaatcaattactgctgatggggagtctccaccttccacaaag
atcaatgtggatgacctccaacccaatgaaaatgaggagaaaggttcctatcccaatcca
gaagctggaggagaagaagaggaagaggagcctgagatgcctgtgggcccccgtcctcgc
ccactctctgaattgcacctcaaggagaaagcagtacccatgccagaagccagtgcattt
ttcatctttggccataacaacaggttccgtcttcagtgccatcgcattgtcaacaacaat
gtttttaccaatctgatcctcttcttcattctgctcagcagcatctccctggctgctgag
gacccagtccgccacaactcctttcggaaccaaattctgtttcattttgatatagttttt
actaccattttcaccattgaaattgctctgaagatgaccgcctatggggctttcctccac
aagggctctttctgcaggaactacttcaacatcttggacctcctcgtggtcagcgtgtcc
ctgatctccttcggtatccagtccagtgccatcaatgttgtcaagatcttgagagttctt
agagtactcagacccctgagagctatcaatcgggccaagggattaaagcatgtggtccag
tgtgtgtttgttgctatccgaaccatagggaacattgtgattgtcacgacgcttctgcag
ttcatgtttgcctgcattggggtacagctgttcaagggcaaactctacacctgcacagac
agttccaaacagactgaggcagaatgcaagggcaattatatcacgtacaaagatggtgag
gtagatcatcccataattcagcctcgaagttgggagaatagcaaatttgactttgacaat
gtcttgactgccatgatggccctcttcactgtctccacctttgaggggtggccagagctt
ctataccgatccatcgactcacacactgaagataagggacccatctacaactatcgagta
gagatctccatcttcttcatcatctacatcatcatcatcgccttctttatgatgaatatc
tttgtgggtttcgtcattgtcaccttccaggagcagggagaacaggagtacaagaactgt
gaactggacaagaaccagcgacagtgcgtagaatatgctctcaaggctcgacccttgaga
aggtacatccccaagaaccaacaccagtataaagtgtggtatgtggtcaattccacctat
tttgaatacttgatgttcgtcctcatccttctcaacaccatctgcttggccatgcagcac
tacggtcaaagctgtcttttcaaaattgccatgaacattctcaacatgctcttcactggc
ctcttcactgtcgagatgatcctgaaactcattgcattcaaacccaagcactatttctgt
gatgcatggaatacatttgacgccttgattgttgtgggtagcattgttgatatagcaatc
accgaggtaaacccagctgaacatacccaatgctctccctctatgaatgcagaggagaat
tcccggatctccatcaccttcttccgtctcttccgggtcatgcgtctcgtcaagttgctg
agccgtggggagggcatccgcaccctgctctggactttcatcaaatctttccaggctcta
ccctatgtggctcttctgatagtgatgttgttcttcatctatgctgtcattggaatgcag
gtgtttggcaaaattgccctgaatgataccacagaaatcaatcggaacaacaacttccag
acctttcctcaagctgtgctgctactcttcaggtgtgccacaggagaagcatggcaagat
atcatgctggcctgtcttccaggaaagaaatgtgctcctgagtctgagtcaagtaacagt
actgagtcagaaacgtactgtggcagcagctttgccgtgttctattttatcagtttctac
atgctctgtgcctttctgatcatcaacctctttgtagctgtcatcatggacaactttgac
tacctgacaagagactggtccatcctaggtccccatcacttggatgaattcaaaaggatc
tgggcagaatatgaccccgaagctaagggtcgtatcaaacacctggacgtggtaacctta
ctccggaggatccagccccctctggggtttggaaagctgtgccctcatcgagtggcatgc
aaacgtctggtgtccatgaacatgcctctgaacagtgatgggactgtaatgttcaatgct
accttatttgccctggtcaggacagccttgaggatcaaaacagaagggaacctggaacaa
gccaatgaagagttgcgagcaattatcaagaagatctggaaacggactagcatgaagctc
ctagaccaagtggttcctccagctggtgatgatgaggtgactgttgggaagttctacgcc
accttcctgatccaagagtatttccgaaaatttaagaagcgcaaagagcaagggctagta
ggcaagccttcccaaaggaatgcactgtctctacaggctggtcttcgtacactgcatgat
attggaccagagattcgacgggccatctctggggacctgacagccgaggaggagttggac
aaggccatgaaggaagctgtttctgctgcctctgaagatgacatctttaggagggccggt
ggcctgtttggcaatcatgtcacctactaccaaagcgatggtcgaagctccttcccccag
accttcaccacccagcgcccactgcatatcaacaaggcgggtaacagccaaggcgacaca
gagtcaccatcccatgagaaactggtggactccacattcactcccagcagctactcatcc
tctggttccaatgccaacatcaacaacgccaacaacactgccctgggccgcttcccctgt
cccaccggttaccccagtacggtcagcacagtggagggccatgggacccccttgtcccct
gccatccgggtgcacgagacagcatggaagctcagctccaggagataccactcccgggac
agccggatagctatgatgtgtcccgaggaggcagcccccaccaagagctttgaagggaac
gtgaatgaggacacagaatactgcagcgagcccagcctgatctccactgagatgctctcc
tatcaggatgatgaaaacagacaactgacacctccagaagacaaaactaggcaatctatg
aaaagaggtttccttcactcttcctcactaggtcgaagagcctctttccatttggagtgt
ctaaagcgacaaaagaaccaagggggagacatctctcagaagacagtgttgcccttgcat
ctggttcatcaccaggcactggcagtgacaggtctcagccctctccttcagagaagccat
tctccaagtaccacattccctaggccaagtgctacccccccagcaactcctcatggccaa
gcctggccgcaacagcccattcccacactgtggttagaaggagcggagtccaatgagaag
ctcaacagcagcttcccatccatccactgcagttcctggtatgcagagaatgccagctgt
ggagccagcagaggcggtgcctcccggagagcccggccagtctccctcactgtgcccagc
cagtctggggcagctggcaggcaattccatggcagtgctagcagcctagttgaagcggtc
ttgatttcggaaggactgggacagtttgcccaagatcccaagttcatcgaagtcacaacc
caagaacttgctgatgcctgtgatatgacaatagaggagatggagaatgcagctgacaat
attctcagtggtagcagcaagcagagccccaatggcaacctattaccttttattaactgc
agggacgcggggcaggaccaagcaggtggtgaggaggaggagggaatgcccaaccccgaa
tgtcgaaagagtcaggaggagctccaggacagcagagtttatatcagcagcctgtag

DBGET integrated database retrieval system