KEGG   Sarcophilus harrisii (Tasmanian devil): 100926701
Entry
100926701         CDS       T02286                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator isoform X3
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01523  Antifolate resistance
shr04010  MAPK signaling pathway
shr04014  Ras signaling pathway
shr04062  Chemokine signaling pathway
shr04064  NF-kappa B signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04210  Apoptosis
shr04380  Osteoclast differentiation
shr04620  Toll-like receptor signaling pathway
shr04621  NOD-like receptor signaling pathway
shr04622  RIG-I-like receptor signaling pathway
shr04623  Cytosolic DNA-sensing pathway
shr04625  C-type lectin receptor signaling pathway
shr04657  IL-17 signaling pathway
shr04658  Th1 and Th2 cell differentiation
shr04659  Th17 cell differentiation
shr04660  T cell receptor signaling pathway
shr04662  B cell receptor signaling pathway
shr04668  TNF signaling pathway
shr04920  Adipocytokine signaling pathway
shr05132  Salmonella infection
shr05135  Yersinia infection
shr05142  Chagas disease
shr05145  Toxoplasmosis
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05162  Measles
shr05163  Human cytomegalovirus infection
shr05164  Influenza A
shr05165  Human papillomavirus infection
shr05166  Human T-cell leukemia virus 1 infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05168  Herpes simplex virus 1 infection
shr05169  Epstein-Barr virus infection
shr05170  Human immunodeficiency virus 1 infection
shr05200  Pathways in cancer
shr05203  Viral carcinogenesis
shr05212  Pancreatic cancer
shr05215  Prostate cancer
shr05220  Chronic myeloid leukemia
shr05221  Acute myeloid leukemia
shr05222  Small cell lung cancer
shr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
shr05340  Primary immunodeficiency
shr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100926701 (IKBKG)
   04014 Ras signaling pathway
    100926701 (IKBKG)
   04064 NF-kappa B signaling pathway
    100926701 (IKBKG)
   04668 TNF signaling pathway
    100926701 (IKBKG)
   04151 PI3K-Akt signaling pathway
    100926701 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100926701 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100926701 (IKBKG)
   04621 NOD-like receptor signaling pathway
    100926701 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    100926701 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    100926701 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    100926701 (IKBKG)
   04660 T cell receptor signaling pathway
    100926701 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    100926701 (IKBKG)
   04659 Th17 cell differentiation
    100926701 (IKBKG)
   04657 IL-17 signaling pathway
    100926701 (IKBKG)
   04662 B cell receptor signaling pathway
    100926701 (IKBKG)
   04062 Chemokine signaling pathway
    100926701 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100926701 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100926701 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100926701 (IKBKG)
   05203 Viral carcinogenesis
    100926701 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100926701 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100926701 (IKBKG)
   05221 Acute myeloid leukemia
    100926701 (IKBKG)
   05220 Chronic myeloid leukemia
    100926701 (IKBKG)
   05215 Prostate cancer
    100926701 (IKBKG)
   05222 Small cell lung cancer
    100926701 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    100926701 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100926701 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100926701 (IKBKG)
   05135 Yersinia infection
    100926701 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100926701 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    100926701 (IKBKG)
   05162 Measles
    100926701 (IKBKG)
   05164 Influenza A
    100926701 (IKBKG)
   05161 Hepatitis B
    100926701 (IKBKG)
   05160 Hepatitis C
    100926701 (IKBKG)
   05168 Herpes simplex virus 1 infection
    100926701 (IKBKG)
   05163 Human cytomegalovirus infection
    100926701 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100926701 (IKBKG)
   05169 Epstein-Barr virus infection
    100926701 (IKBKG)
   05165 Human papillomavirus infection
    100926701 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100926701 (IKBKG)
   05142 Chagas disease
    100926701 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100926701 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100926701 (IKBKG)
Protein kinases [BR:shr01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100926701 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 zf_C2H2_ZHX LLC1
Other DBs
NCBI-GeneID: 100926701
NCBI-ProteinID: XP_012408965
LinkDB
Position
X
AA seq 563 aa
MNENHCKSQPCEMVQPNGGPSGDYGTLGEGSSLGKSAMLHLPSNQVSPEALQRCLEENQE
LRDALRQSNHMLRQRYQEFLNFQANQKEEKEFLMQKFQEARKLVEKLNMEKLELKRQKEK
ALQESEEGQIPGETEKEALRTLKEQLEERLRQFQETNESLQKEKEVLLLENQELRKQAAR
GPAGESQPRTKDSEIQPQGLPETESLQGASGRSGDSSESLKKKMQDVENENTALKQELVS
LQGKMAQMAVREKDVERRAEQQLQALKRQVEQLTEDKGSVKAQVTSLLGELQESQSRLEI
SNKDKQVLEDRARTASERVKHLESENEQLHKQHSVQVEQLRMQTQNVEAALRMERQAASE
EKRKLAQLQVAYRQLFQEYDNHIKNSQASSERSRGMDLQLEDLNQQLQQAEEALVAKQEL
IDKLKEEAEQHKTVMETIPVLKAQADIYKADFQAERQAREKLAERKELLQDQLQQLQREY
NKLRVDSKENTRIEDMRKRHVENPQPALPQPVHLINHHLSFHPIPPGQRRSLPDEQPDFC
CPKCQYQAPDIDTLQIHVMECIE
NT seq 1692 nt   +upstreamnt  +downstreamnt
atgaacgagaatcattgcaagagtcagccttgtgagatggtacagcccaacgggggtcca
tcaggagattacgggacccttggtgaagggtcttccctggggaaatcagccatgctgcat
ctcccttccaaccaagtctctccagaggccctccagcgctgcttggaggagaaccaagag
ctcagagatgccttacgacagagcaaccacatgcttcggcagcgttatcaagaattcctg
aactttcaagccaaccagaaggaggagaaggagttcctcatgcaaaaatttcaggaggcc
aggaagctggtggagaagttaaacatggagaagctggaactgaagagacagaaggagaag
gcactgcaagaaagcgaggagggtcagattccgggcgagacggaaaaagaggctttgagg
accctgaaagagcagctagaggaacgtttgcgacaatttcaggagaccaatgaaagcctc
cagaaagagaaagaagttcttctcctagagaaccaggaactaaggaagcaagcggcccgg
gggccggctggggagagccagccgaggaccaaggacagcgaaatccaaccgcaaggactg
ccggagacagaatctttgcagggggcaagtggcaggagtggtgattcaagtgaatcgctg
aagaagaagatgcaggatgttgagaacgagaacacggcgctgaagcaggagctggtgtcc
ctgcagggcaagatggcccaaatggcagtgagggaaaaagatgtggagaggagggctgag
cagcagttacaggccctgaagaggcaggtggagcaactgacagaagacaaaggctctgtg
aaagcccaggtgacctccctgcttggagagctgcaggagagccagagccgcttggagatc
tccaataaggacaaacaagtcctagaggacagagcccggacagccagtgagagagtcaag
catctggagagtgagaacgaacagctgcacaaacagcacagtgtgcaggtggagcagcta
cgcatgcagacccagaacgtggaggctgccctgcggatggagcggcaggccgcatctgag
gagaagcggaagttggctcagttacaggtggcctaccgccagctctttcaggagtatgac
aaccacatcaagaacagccaggcgagcagtgagcgcagtaggggaatggatcttcagttg
gaagaccttaaccagcagttgcaacaggcagaagaggccctggtagccaaacaagaattg
atcgacaaactcaaggaggaggccgaacagcacaagacggtgatggagaccattcctgtc
ctgaaggcacaggccgatatctacaaggctgacttccaggcagagaggcaggcccgggaa
aaactggccgagcggaaagaacttctgcaggatcagctgcagcaactccagagggagtat
aacaaactgagggttgactcgaaagaaaatacccgtattgaagatatgagaaaacggcac
gtggagaacccccagccagccttgccccagccggttcatcttatcaaccatcacctctcc
tttcatcccataccacctggccagaggagaagtctcccagatgagcaaccagatttttgt
tgtccgaagtgtcagtaccaggccccagatatcgacaccctgcagatacacgtcatggag
tgtattgagtga

DBGET integrated database retrieval system