KEGG   Sarcophilus harrisii (Tasmanian devil): 100931481
Entry
100931481         CDS       T02286                                 

Gene name
CASP9
Definition
(RefSeq) caspase-9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01524  Platinum drug resistance
shr04115  p53 signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04210  Apoptosis
shr04215  Apoptosis - multiple species
shr04370  VEGF signaling pathway
shr04919  Thyroid hormone signaling pathway
shr05010  Alzheimer disease
shr05012  Parkinson disease
shr05014  Amyotrophic lateral sclerosis
shr05016  Huntington disease
shr05020  Prion disease
shr05022  Pathways of neurodegeneration - multiple diseases
shr05134  Legionellosis
shr05145  Toxoplasmosis
shr05152  Tuberculosis
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05162  Measles
shr05163  Human cytomegalovirus infection
shr05164  Influenza A
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05168  Herpes simplex virus 1 infection
shr05169  Epstein-Barr virus infection
shr05170  Human immunodeficiency virus 1 infection
shr05200  Pathways in cancer
shr05210  Colorectal cancer
shr05212  Pancreatic cancer
shr05213  Endometrial cancer
shr05215  Prostate cancer
shr05222  Small cell lung cancer
shr05223  Non-small cell lung cancer
shr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100931481 (CASP9)
   04151 PI3K-Akt signaling pathway
    100931481 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100931481 (CASP9)
   04215 Apoptosis - multiple species
    100931481 (CASP9)
   04115 p53 signaling pathway
    100931481 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100931481 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100931481 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100931481 (CASP9)
   05212 Pancreatic cancer
    100931481 (CASP9)
   05215 Prostate cancer
    100931481 (CASP9)
   05213 Endometrial cancer
    100931481 (CASP9)
   05222 Small cell lung cancer
    100931481 (CASP9)
   05223 Non-small cell lung cancer
    100931481 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100931481 (CASP9)
   05012 Parkinson disease
    100931481 (CASP9)
   05014 Amyotrophic lateral sclerosis
    100931481 (CASP9)
   05016 Huntington disease
    100931481 (CASP9)
   05020 Prion disease
    100931481 (CASP9)
   05022 Pathways of neurodegeneration - multiple diseases
    100931481 (CASP9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100931481 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100931481 (CASP9)
   05152 Tuberculosis
    100931481 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100931481 (CASP9)
   05161 Hepatitis B
    100931481 (CASP9)
   05160 Hepatitis C
    100931481 (CASP9)
   05164 Influenza A
    100931481 (CASP9)
   05162 Measles
    100931481 (CASP9)
   05168 Herpes simplex virus 1 infection
    100931481 (CASP9)
   05163 Human cytomegalovirus infection
    100931481 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100931481 (CASP9)
   05169 Epstein-Barr virus infection
    100931481 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100931481 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100931481 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:shr01009]
    100931481 (CASP9)
   01002 Peptidases and inhibitors [BR:shr01002]
    100931481 (CASP9)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     100931481 (CASP9)
Protein phosphatases and associated proteins [BR:shr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100931481 (CASP9)
Peptidases and inhibitors [BR:shr01002]
 Cysteine peptidases
  Family C14: caspase family
   100931481 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 100931481
NCBI-ProteinID: XP_003765130
LinkDB
Position
3
AA seq 426 aa
MEEAQRELFQRHRLRLVKELQVEPLWALMLERELFTRDMIEDLQSAGTRRDQARQLITDL
QTRGKQALPIFISCLEDTDQWPLAALLREGNTTQQLETVDIEPVEMNRSEGASGTQEKLP
IKPVDSGSPTSKKEEQKEQGTSSLGVVEGAVGPPRARGGRNPALVGQVYPLTSDPCGYCL
IINNVDFSAASGLSVRTGSNIDCEKMQKRFQALHFAVEVEWNLTAKAMGTTLQHLAQRDH
SALDCCVVVILSHGRQASHIQFPGAICGTDGGSISVEKIVNFFSGSRCPSLGGKPKLFFI
QACGGDQKDHGFQVCFNTIEDNFFIEADATPFQTNFDQPDAVANLPTPSDILVSYSTFPG
FVSWRDKKIGSWYIETLDRVLGEWADTEDLLSILLMVSNAVSSKGTFKQIPGCFNFLRKR
FFFKTK
NT seq 1281 nt   +upstreamnt  +downstreamnt
atggaggaggctcagcgggagctcttccagcggcaccggctgcgcctggtgaaggagctg
caggtggagccgctgtgggctctgatgctggagcgggagctcttcactcgcgacatgatc
gaagacctccagagcgctggtactcgcagagatcaggctagacagttgatcacagatctt
cagactagagggaagcaagcacttcccatcttcatttcttgcctggaagacactgaccaa
tggcctctagcagctcttctccgtgaaggaaacacaacccagcaactggaaactgttgac
atcgaaccagttgagatgaacagatctgagggagcaagtggcacacaggagaagcttccc
ataaaaccagtggactcaggctctcccaccagcaagaaagaagaacaaaaagaacaagga
acatcatccttgggtgtcgtagagggtgctgtggggcctccacgggccagaggtgggaga
aatcctgctttggttggacaggtgtatcctctgacctcagacccatgtggctactgtctc
atcatcaacaatgtggacttcagtgctgcttcaggcctttctgtccgaacaggctctaac
attgactgtgaaaagatgcagaaacgcttccaagcactgcattttgctgtggaggtcgag
tggaatctgactgcaaaggcgatgggaacaaccttgcagcacctggcccagagggaccac
agcgccctggactgctgcgtggtggtcattctgtctcacgggcgtcaggccagtcacatc
cagtttcctggagccatctgcggcacggatggaggctccatttcggtcgagaagattgtg
aacttcttcagtgggtccagatgccccagcctgggagggaaacccaagcttttctttatc
caggcctgtggcggcgatcagaaagaccatggatttcaggtgtgtttcaatactattgag
gacaacttctttattgaggcagacgccacccctttccagactaactttgatcaaccagat
gctgtggccaacttaccgaccccgagtgacatcttggtgtcctattccacatttcctggg
ttcgtctcctggagggataagaagattggttcatggtacatagaaaccctggatagagtc
ttgggggaatgggcggataccgaagacttactgagtatccttctcatggtgtctaatgct
gtatcctccaaagggacattcaaacagattcctggttgttttaatttcctccggaagaga
tttttctttaaaaccaagtaa

DBGET integrated database retrieval system