KEGG   Sarcophilus harrisii (Tasmanian devil): 100933026Help
Entry
100933026         CDS       T02286                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00052  Galactose metabolism
shr00500  Starch and sucrose metabolism
shr01100  Metabolic pathways
shr04142  Lysosome
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100933026
   00500 Starch and sucrose metabolism
    100933026
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100933026
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shr04147]
    100933026
Enzymes [BR:shr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100933026
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100933026
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100933026
NCBI-ProteinID: XP_012398268
LinkDB All DBs
Position
2
AA seq 929 aa AA seqDB search
MKSYHKLPTHVTPAPGPYCEEEEEEEDEGHGPGFPAVKKTLSLRWRWLGMAVVVGAVLLG
GTFWAVSLQRLPGEPLGRCSPVPEAQRFDCYPERDAVVTPELCHLRGCCFLQSGSRGGPP
WCFYPPDFPSYTLQSLNRTELGFLGLLTRTVKTYYPRDVLELQLQVDLETDTRLHIKLTD
PHHSRYEVPLEVPPTMKKAENPLYSLDFSRDPFGILVKRRGSGVVLLNTTVAPLIFADQF
LQISTLLPSAFLYGLGEHRRGFLHHLDWTTLSFWARDVPPTESFNLYGAHPFYLNMEEAG
SAHGVFLLNSNAMEVVLQPAPALTWRTVGGVLDLYVFLGPDPSSVVQQYQQVIGFPTMPP
LWGLGFHLCRWGYGSSNQTWETVKNMRNYLIPQDAQWNDIDYMEGSRDFTVDPEHFGTLP
QLVMDLHKHGQYYVPIVDPAISSSQPTGTYAPYDEGLKRGIFINNTNGQPLIGQVWPGLT
AFPDFSNPETHQWWLENLNVFHAQVPFDGLWIDMNEPSNFQDGSVDGCTSEELDNPPYKP
AVLGGSLFAKTICASAKQRLSSHYNLHNLYGLMEAKATASALIAIRGKRPFVISRSTFPS
QGRYSGHWLGDNRSEWKDMYWSIPGLLNFNLFGIPLVGADICGFSGSTTEELCTRWMQLG
AFYPFARNHNAKDVQAQDPTVFSPPARTVMKGALMTRYALLPYLYTLFHHAHRRGDTVAR
PLLFEFPRDTNTYALDRQFLWGRSLLVTPVLESGVDAVTGYFPSGLWYDYYSGSPLQSQG
EEVKLAAPLNHINVHIREGAVLPTQKPDITSWMSSGNPLLLVAALSQEGIAWGDLFWDDG
ESLDTFERGNYSYVVFNVSQNIFTSTVLHCNLEAIYITVDGLTVYGVQKQPQVVTVNGQE
IPFSYLENQVLSMSGLNLNLSQSFSIQWI
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgtaccacaaattgcccacccatgtgactcctgctcctggtccttactgtgag
gaggaagaagaagaggaagatgagggccatggccccggcttccccgctgtcaagaagacc
ctgtccctcaggtggcggtggctaggaatggctgtggtggtgggggctgtcctgctgggg
ggcaccttctgggccgtcagcctccagagacttcctggagagcctctggggaggtgcagc
ccggttcccgaggcccagcgatttgattgctaccctgagcgggacgcggtggtgacccca
gaactctgccacctgagaggctgctgcttcctgcagagcggcagccggggagggccgccc
tggtgcttctacccccctgacttccccagctacaccctgcagtcactgaacaggaccgaa
ctgggcttcctggggctgctgacgaggacagtgaagacctattatccccgggatgtgctg
gagttgcagctgcaggtggatttggagacagacacccggctacacatcaagctgactgat
ccccaccactccagatacgaggtacctctggaagttccgccaaccatgaaaaaagcagag
aaccccctctacagcctcgatttctccagggatccctttgggattttggtgaaacgtcgg
gggtcaggagttgtactgttgaacacaactgtggctccattaatctttgctgaccagttc
cttcagatctctactcttcttccatctgcattcctctatgggctgggggagcatcgccgt
ggctttcttcaccacttggattggaccaccctgagtttttgggcccgggatgtgccaccc
acggagtcattcaatctttatggggcgcaccccttttacttgaatatggaagaggcagga
tctgctcatggcgttttcctcctgaatagcaatgccatggaggtggttctgcagcctgcc
ccggcgctgacgtggaggacggtggggggcgttctggacttgtatgtcttcctggggcca
gacccgagctccgtggtccagcagtaccagcaggtcatcggcttccctactatgccgcct
ctctggggacttggcttccatctttgccgctggggttatggcagcagcaaccagacctgg
gagacggtgaaaaacatgaggaattatctcatcccccaggatgctcagtggaatgacatt
gactacatggaaggatctcgggatttcaccgttgacccagagcattttggcacactcccc
cagctggtgatggaccttcacaagcatggacaatattatgtcccaattgtggatcctgcc
atcagcagcagtcagcctactggcacttacgcaccttatgatgaaggtttgaaaagaggg
atcttcattaacaacaccaatggacagccattgattggacaggtgtggcccggcctcact
gcattccctgacttctccaacccagagacacatcagtggtggctagagaacctgaatgta
ttccacgcccaagttccctttgatggactctggattgacatgaatgaaccatctaacttc
caggatggttcagtggatggttgcacttctgaagaattggataacccaccctacaaaccc
gcggtgctgggaggatctttatttgccaagacaatctgtgcctctgcaaagcaaaggctc
tcctcccactataaccttcataacttgtatgggctgatggaagctaaagctactgccagt
gccctgattgctatccgtgggaagcgcccatttgtcatttcccgatccacctttcccagt
cagggccgctactctgggcactggctgggagacaacaggagtgaatggaaggatatgtac
tggtcaataccaggtttgctaaacttcaatctctttgggattcctttggttggagctgat
atctgtggattttcaggatctactactgaagaattatgtactcgatggatgcagcttgga
gccttttatccttttgcccgaaaccacaatgccaaagatgtacaggcccaggatcccacg
gtattcagccctccggcacggacagtcatgaagggagccctcatgacccgatacgccctt
ctgccctacctctacaccctcttccaccatgcccaccgccggggcgacaccgtggcccgg
cccctgctcttcgaattcccccgagacacaaacacctatgccctggaccggcagttctta
tggggacggagtctcctggtgacccctgtcttggagtcaggtgtagatgcagtgactggc
tacttccccagcgggctctggtatgactactattcgggctcacctctgcaaagccaagga
gaagaagtgaagctggcagctcctcttaaccatataaatgtacacattcgtgaaggtgct
gtcctccccacccagaaaccagacatcaccagctggatgagcagtggaaatcctttgctt
ctggtagctgctctgtcccaggagggcatagcctggggggaccttttctgggatgatggg
gagagcctggacacctttgaaagaggcaactattcctatgtggtatttaacgtctcacag
aatattttcacatccacggtccttcactgcaatttggaagctatttatatcacagtggat
ggactgacagtctatggagtacagaaacaacctcaggtggtcactgttaatggccaagaa
atccccttctcctacctagagaaccaggttctcagcatgagtggccttaatctgaacctc
agccagtccttctccatacagtggatttga

DBGET integrated database retrieval system