KEGG   Sarcophilus harrisii (Tasmanian devil): 100933169
Entry
100933169         CDS       T02286                                 

Gene name
EGF
Definition
(RefSeq) pro-epidermal growth factor isoform X1
  KO
K04357  epidermal growth factor
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr04010  MAPK signaling pathway
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04015  Rap1 signaling pathway
shr04020  Calcium signaling pathway
shr04066  HIF-1 signaling pathway
shr04068  FoxO signaling pathway
shr04072  Phospholipase D signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04510  Focal adhesion
shr04540  Gap junction
shr04630  JAK-STAT signaling pathway
shr04810  Regulation of actin cytoskeleton
shr05160  Hepatitis C
shr05165  Human papillomavirus infection
shr05200  Pathways in cancer
shr05210  Colorectal cancer
shr05212  Pancreatic cancer
shr05213  Endometrial cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05218  Melanoma
shr05219  Bladder cancer
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05226  Gastric cancer
shr05231  Choline metabolism in cancer
shr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100933169 (EGF)
   04012 ErbB signaling pathway
    100933169 (EGF)
   04014 Ras signaling pathway
    100933169 (EGF)
   04015 Rap1 signaling pathway
    100933169 (EGF)
   04630 JAK-STAT signaling pathway
    100933169 (EGF)
   04066 HIF-1 signaling pathway
    100933169 (EGF)
   04068 FoxO signaling pathway
    100933169 (EGF)
   04020 Calcium signaling pathway
    100933169 (EGF)
   04072 Phospholipase D signaling pathway
    100933169 (EGF)
   04151 PI3K-Akt signaling pathway
    100933169 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100933169 (EGF)
   04540 Gap junction
    100933169 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100933169 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100933169 (EGF)
   05231 Choline metabolism in cancer
    100933169 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100933169 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100933169 (EGF)
   05212 Pancreatic cancer
    100933169 (EGF)
   05226 Gastric cancer
    100933169 (EGF)
   05214 Glioma
    100933169 (EGF)
   05218 Melanoma
    100933169 (EGF)
   05219 Bladder cancer
    100933169 (EGF)
   05215 Prostate cancer
    100933169 (EGF)
   05213 Endometrial cancer
    100933169 (EGF)
   05224 Breast cancer
    100933169 (EGF)
   05223 Non-small cell lung cancer
    100933169 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100933169 (EGF)
   05165 Human papillomavirus infection
    100933169 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100933169 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:shr04052]
    100933169 (EGF)
Cytokines and growth factors [BR:shr04052]
 Growth factors
  Growth factors (RTK binding)
   100933169 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition EGF cEGF EGF_CA EGF_3 ETRAMP DUF4366 GAPT hEGF
Other DBs
NCBI-GeneID: 100933169
NCBI-ProteinID: XP_031799579
Ensembl: ENSSHAG00000001762
LinkDB
Position
6
AA seq 1129 aa
MMWLFFLPWPLVFAFSVASVSGPQLQNTKCPPLSAEGNWRMTGTGPEPFLIFSHGNAIFR
TDMEGTNHKQVVANAGKTVLMDFDYRKEKVYWVDLERGLLQKVFLNGTKKETLCRTEKGI
SGMAIDWIHDEIVWSNQLKGTIETTDMKGNNSHVLLKELNYPKNVVLDPIKRFIFWVANN
ITSTINRANINGTDVKILMQISQTIKTISLDILEQRLFWIQDSSEESDLHVASCNYDGGS
VHLLSYFTQYHYFGMSLFVENMYYSEWNTSAIWSVNKHTGQKMVKISLKPSFLPPTEIKV
VHQLLQPTVRNDTQNSEQEVCTLKKGYCKSSICGQNLKSHPCKCAEGYTLSQDGKYCKDV
NECVFWNHGCTLGCKNIPGSYYCTCPKGFILLSDGKRCQELISCVNNNTGCSHGCVMTSD
GPMCFCPEGSVLGEDGKTCSGCSSIDNGGCSQICIPLSPVSWECGCFPGYELQLNQKSCK
AKGPQPFLLFANMRDIRRINFDGTKYESLLSRQMGEVLALDHDPVENKIYFAHTTLKWIE
RANMDGSEREILIQEGVDTPESLAVDWIDRKFYWTDRGKSHIARSDLNGKYNEVIIEEDV
SQPRGVAVHPMAKKLFWTDLGINPQIESSSLQGNDRLIIANTDLVWPSGITIDYVDNKLY
WCDAKKSVIEVANLDGSGRRRLIQNDVDHPFDVAVFEDHVWFSNWAKPSVIRVDKRTGQN
RVCLRGSMLRPSSLVVIHPLAKPASQMNANNDTALLENVLGKTVEEKTREEQEPKHGLVA
EIMISDEDSCASVNCGVNAQCISKGKDAWCECLEGFIKNATLCSDIDECAMDNVLCQPES
SECINTEGDYVCKCLEGYSGDGLNCYDIDECEMGTHTCGENALCKNTVGGYTCICSNGAP
GFGSVCPESFQPGDDVFSLIRNRQSECPPSYDSYCLHGGVCIYVSELENYACKCMVGYVG
ERCQHSDLEWWEMRHMAKAKQQNITIAVCIIVLVLLLLLALGVTYYFRTQKLHKKNPTSE
MTGESVVASTFGEDMMLSNHKPWVLVVKEQPQCSTGSHQVNFTDCQTTNGDQPSPPESGY
MWMESWNREIQTIEEMGKNQNYQHQPSIDQLHPQGIEENPHHFLPSGPL
NT seq 3390 nt   +upstreamnt  +downstreamnt
atgatgtggctgttctttcttccttggccactggtctttgcgtttagtgtggctagtgtc
tcaggcccgcagcttcagaacacaaaatgccctccgctctctgccgaggggaattggcgt
atgactggtaccggccctgaacccttcttaattttcagccatggaaatgctatctttagg
actgacatggaaggaactaatcacaaacaagtggtagctaatgctggcaagacagtattg
atggattttgattatagaaaggagaaagtgtattgggtggatttagaaagaggacttctg
caaaaagtattcctgaatggcacaaagaaagagactctgtgccgtacagagaaagggatt
tcaggaatggcaatagattggatacatgatgaaattgtttggtccaatcaactgaaagga
acaattgaaactacagacatgaaagggaacaattctcatgtcctcttgaaagaattaaat
tatcctaaaaatgttgttcttgatccaataaaaaggtttatattttgggtggcaaataat
attactagcactataaacagagcaaatattaatgggacagatgtgaagattctaatgcag
atatcacaaacaattaaaactatctcactggacatccttgagcagagactcttttggatt
caggacagcagtgaagaaagtgaccttcatgttgcctcatgtaattatgatggaggctct
gttcacctgctgagttattttacacaataccattattttggaatgtctctgtttgttgaa
aatatgtattattcagaatggaatacaagtgccatttggagtgtcaataaacacacagga
caaaagatggttaaaattagccttaagccatcatttctaccaccaactgaaataaaagta
gtacatcaactcttgcagcctacagtaagaaatgatactcagaattctgagcaggaagta
tgcactttaaagaaaggttactgcaagagcagcatatgtggacagaaccttaagtcccat
ccatgcaaatgtgcagaaggttatacattaagccaagatgggaagtattgcaaagatgtc
aatgaatgtgtattttggaaccatggatgtactcttggttgtaaaaacatccctggatcc
tattactgcacatgtcccaaagggttcatcctgctctcagatggaaaaagatgtcaagaa
ttaatttcctgtgtaaacaacaacactggatgcagccatggttgtgtcatgacatcagat
ggtccaatgtgtttctgtcctgaagggtcagtgcttggggaagatggaaaaacatgcagt
ggctgttcatcaatagataatggtgggtgtagccagatctgcatccctctaagcccagtg
tcttgggaatgtggttgctttcctggatatgagctgcaattgaatcaaaagagctgcaag
gctaaaggacctcagccctttttactgtttgccaatatgcgggatattcggcgaatcaac
tttgatgggacaaagtatgaaagcctactcagccggcagatgggagaggtcttagcatta
gatcatgatccggttgaaaataagatttactttgcacacacaacactgaagtggatagag
agagctaatatggatggctcagagcgtgaaatactcattcaggaaggagtagacacacca
gaaagtcttgctgtggattggattgatcgtaaattctattggacagaccgagggaaatcg
cacattgccaggagtgatttgaatggaaaatacaatgaagtaatcattgaggaagatgtg
tctcaaccaagaggagttgctgttcatccaatggccaagaagttattctggactgatttg
ggaattaatcctcaaattgaaagctcttctcttcaaggcaatgatcggctgattatagcc
aatactgatctggtctggcctagtggaataacgattgattatgtagataacaagttgtat
tggtgtgatgccaagaaatctgttattgaagtggccaatctggatggttcgggacgccga
agacttatccagaatgatgtagatcacccatttgatgtggctgtatttgaggatcatgtt
tggttctctaattgggctaagccttcagtaataagggtggacaagaggactggccaaaac
agggtatgtcttcgaggcagcatgctgaggccctcatccttggttgtaattcatcctttg
gcaaaaccagccagtcagatgaatgcaaataatgatacagcactactggagaatgtgttg
ggaaaaacagtagaagaaaaaaccagggaagaacaagaacccaaacatggactagtagct
gaaatcatgatttcagatgaggacagctgtgcctctgtgaattgtggtgtgaatgctcag
tgcatttcaaagggaaaggatgcctggtgtgagtgcttggaaggattcatcaagaatgca
accctatgctctgatattgatgaatgcgcaatggataatgtactttgccagccagaatca
tctgaatgcatcaacactgagggtgactatgtctgcaagtgtttggaaggctacagtgga
gatgggttaaactgttatgacattgatgagtgtgaaatgggaacacatacatgtggagaa
aatgccctctgtaaaaatacagtgggaggttacacctgcatctgctctaatggtgcacct
gggtttggatctgtttgtcctgaatctttccagcctggagatgatgttttctccctcatc
agaaacaggcaatcagagtgtccaccatcatatgattcatattgcctccatggaggagtg
tgtatttatgtttcagaactggaaaactatgcgtgcaaatgcatggttggctacgtggga
gagcgctgtcagcatagtgacctggaatggtgggagatgcggcacatggcaaaggcaaaa
cagcagaacatcaccattgcagtctgcataattgtgctggttctgttgcttcttctggcc
ttgggggtgacttactatttcaggactcagaagctccataagaagaatccaacctctgag
atgacaggggaatccgtagttgccagtacctttggagaagacatgatgctttctaatcac
aagccttgggttttggttgtgaaggaacaaccacaatgcagtactggaagtcatcaggtg
aacttcacagactgtcagactacaaatggtgatcaaccttcaccccctgaatctggctat
atgtggatggaatcctggaatagagaaatccagaccatagaagagatgggaaaaaatcaa
aactatcagcatcagccatccatagaccagcttcatcctcagggaatagaggaaaatcct
catcattttcttccttcaggtcctctgtag

DBGET integrated database retrieval system