KEGG   Saccoglossus kowalevskii (acorn worm): 100369398Help
Entry
100369398         CDS       T04123                                 

Definition
(RefSeq) TNF receptor-associated factor 2-like
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sko00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100369398
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sko03019]
    100369398
   04121 Ubiquitin system [BR:sko04121]
    100369398
Enzymes [BR:sko01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100369398
Messenger RNA biogenesis [BR:sko03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100369398
Ubiquitin system [BR:sko04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    100369398
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF Baculo_PEP_C SlyX Fez1 DUF812 Sec8_exocyst BLI1 Sec20 YkyA Tropomyosin_1 DUF2730 Exonuc_VII_L HMMR_N
Motif
Other DBs
NCBI-GeneID: 100369398
NCBI-ProteinID: XP_002742434
LinkDB All DBs
Position
Un
AA seq 416 aa AA seqDB search
MLVWLLTELILLLLKHREFLLAWETLSNRSSFFVSPPYENVIHFSVADLKAFITLLMLNG
HLESECSRKMVDCPFQDVGCKTLVRKDDISSHNLTTVGEHSVLLLNQTKELSDVIQNMEC
KRGEVYRIKEQVVEHRTKLSELRTEIQRLCTHMCHTGDQPSVLSQKQNKQVHDTVEQQTK
TLSSFQEKLKSLETNIHTYEGVITVLNNQIEQDARTMHTMQTQAIQHVDRIQALERKVSA
QDQLLKELALAKQDNTMSEMASHDGELVWKITNFLKKRNDAVSRKTVSIYSPCFYTSRHG
YKMCARIYLNGDGMGKGNHVSLFFVIMKGQFDALLRWPFRQKVTLMWLDQNNREHVIDAF
RPDPTSSSFKRPEQDMNVASGCPLFMPLTELNSSRHAYVKDDVAFIKIIVDTTDIT
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtgtggctactaacagaacttatactgctcctgctaaagcatcgcgagtttcta
cttgcatgggaaacgctatcaaacagatcatcattttttgtttcccctccctatgaaaat
gtaatacatttctcagttgctgacttgaaagcgtttattacactgcttatgttaaatggt
catcttgaatctgaatgttcgagaaagatggtagattgtccatttcaggatgttggatgt
aaaacactagtaagaaaagatgacattagtagtcacaatctaacaaccgtcggtgagcat
tctgtattgctattaaatcaaacgaaagaactgtctgatgtgatacaaaatatggaatgc
aaacgtggcgaggtatatcgcataaaagaacaggtggtagaacatcgaaccaagttaagt
gagctccgaacagaaatacagagactatgcacacacatgtgtcacactggggatcaaccc
tctgttctgtctcagaagcaaaacaaacaagtgcatgacactgtagagcaacaaacaaaa
acactatcttcttttcaggagaaattgaaatcacttgaaactaacattcatacatatgaa
ggggtcataactgtgttgaacaatcaaatagaacaagatgcgagaactatgcacaccatg
caaactcaagcaatacaacacgtagatcgcatacaggcattggaacgtaaagtcagtgcg
caagaccaacttttgaaagaattggcactagcaaaacaagataatacaatgtcagagatg
gcatctcatgatggtgagttggtttggaaaattaccaattttctcaaaaaacgcaatgat
gctgtatcgcgtaaaactgtgtcaatttactccccatgtttctacactagtcgccatggt
tacaaaatgtgtgcccgtatttacctcaatggtgatggaatgggaaaaggcaatcatgtg
tctttgttctttgtcatcatgaaaggtcaatttgatgctcttctgagatggccatttcgt
cagaaagttaccttaatgtggttggatcaaaacaacagagagcatgttattgatgcattt
cgacctgatccaacgtccagttctttcaaacgaccagagcaggacatgaatgtggctagt
ggatgtccactatttatgcccttaacggaactaaatagttctcgtcacgcatatgtcaaa
gatgatgtagcttttataaaaatcatagttgatacaactgatataacctaa

DBGET integrated database retrieval system