KEGG   Salinispira pacifica: L21SP2_2213Help
Entry
L21SP2_2213       CDS       T03013                                 

Definition
(GenBank) Pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
slr  Salinispira pacifica
Pathway
slr00330  Arginine and proline metabolism
slr01100  Metabolic pathways
slr01110  Biosynthesis of secondary metabolites
slr01130  Biosynthesis of antibiotics
slr01230  Biosynthesis of amino acids
Module
slr_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:slr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    L21SP2_2213
Enzymes [BR:slr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     L21SP2_2213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 GFO_IDH_MocA 2-Hacid_dh_C Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AHC15576
UniProt: V5WK69
LinkDB All DBs
Position
2362851..2363678
Genome map
AA seq 275 aa AA seqDB search
MPGRDTIRGAGMKTIGIIGFGNMGEAMISGLLDRESGYSLSVIEKSAPRRKLAVETYNAE
DCTDTPEKLFASADAVVLAIKPQDLPALGEEFYSYTEKLPLISIAAGVNLETLKELFGSD
QIARFMPSLAASVGKSVTGISYSDGCSEEFKELSFTVAESFGLAMEMPERLIPAIIGISG
SAIAYVYEFVNALALGGVKNGIKYDSSLEVALDVLEGAVSTIRSSGMTPGELVTKVCSPG
GTTIQGISSLHEDGFTATVMRAVDAAADRARDLES
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcagggatactatacgaggagcaggcatgaaaaccatcggaattatcggtttt
ggaaatatgggcgaagcgatgatctcgggattgcttgaccgggaatccgggtacagcttg
tcggttatcgagaaaagcgctccgcggagaaagcttgcagttgaaacctacaatgccgag
gattgcacggatacgccggaaaaactgttcgcttccgcagacgcggtggtgcttgcaatc
aaaccccaggacctgcctgctctcggcgaggagttttattcatatacggaaaagctccct
ctcatatcaatagccgccggggtgaaccttgagacgctgaaagaactgttcggctcggat
cagatcgcacgctttatgcccagccttgctgcgagcgtgggaaaatcagttaccggaata
tcctattcagacggctgcagtgaagagttcaaggaactgtcttttacggtggcagaatca
tttggcctggcaatggaaatgcccgaacggctgattcccgcaataatcggaatttccggt
tccgccatcgcctatgtatacgagtttgtgaacgccctggccctggggggagtgaaaaac
ggcatcaagtacgattcctctctggaagttgccctggatgtgctggaaggggcggtatcc
accatccgaagcagcgggatgacccccggcgagcttgtcacaaaggtgtgttcacccggc
gggaccaccattcagggcatcagcagcctccatgaggacgggttcaccgccaccgtcatg
agagccgtggatgccgccgcagaccgtgcccgggatctggaaagctga

DBGET integrated database retrieval system