Spinacia oleracea (spinach): 110798000 Help Entry 110798000         CDS       T05137                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism soe  Spinacia oleracea (spinach) Pathway soe03420   Nucleotide excision repair soe04120   Ubiquitin mediated proteolysis soe04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:soe00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110798000    04120 Ubiquitin mediated proteolysis     110798000   09124 Replication and repair    03420 Nucleotide excision repair     110798000  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:soe04121]     110798000    03400 DNA repair and recombination proteins [BR:soe03400]     110798000 Enzymes [BR:soe01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      110798000 Ubiquitin system [BR:soe04121]  Ubiquitin ligases (E3)   UBL E3 ligases    110798000   Multi subunit Ring-finger type E3    SCF complex     Ring finger protein      110798000    Cul2 complex      110798000    Cul3 complex      110798000    Cul4 complex      110798000    Cul7 complex      110798000    Cul8 complex      110798000    Cul9 complex      110798000 DNA repair and recombination proteins [BR:soe03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       110798000     TCR (transcription coupled repair) factors      Cul4-CSA complex       110798000 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Motif Other DBs NCBI-GeneID:  110798000 NCBI-ProteinID:  XP_021858822 UniProt:  A0A9R0J019 LinkDB All DBs Position 2:12938737..12941634 Genome browser AA seq 118 aa AA seqDB search MAATDVSTFVPAGEGSNAAAGPSSSSKKPKRFEIKKWNAVSLWAWDIVVDNCAICRNHIM DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggcagctacagacgtgtcaacttttgttcccgccggcgagggttcgaacgctgctgct ggcccatcttcatcttccaagaaaccgaagcgtttcgaaatcaaaaagtggaacgccgtt tctctctgggcttgggatattgtggtcgataattgcgcaatttgtaggaaccacatcatg gatctctgcattgagtgccaagctaaccaggcgagtgctaccagtgaagagtgtactgtt gcttggggagtgtgcaatcatgcatttcatttccactgcatcagcagatggctgaaaacc cgtcaagtttgtcctctagacaacagcgagtgggagttccagaagtatggccattaa

DBGET integrated database retrieval system