KEGG   Streptomyces pristinaespiralis: SPRI_1929
Entry
SPRI_1929         CDS       T04073                                 

Definition
(GenBank) 2-amino-4,5-dihydroxy-6-one-heptanoic acid-7-phosphate synthase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
spri  Streptomyces pristinaespiralis
Pathway
spri00997  Biosynthesis of various secondary metabolites - part 3
spri01100  Metabolic pathways
spri01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spri00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    SPRI_1929
Enzymes [BR:spri01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     SPRI_1929
SSDB
Motif
Pfam: DeoC
Other DBs
NCBI-ProteinID: ALC20235
UniProt: A0A0M4DD67
LinkDB
Position
2262411..2263379
AA seq 322 aa
MTSYGHFARSLRLRRLYRHSTAGLMITPLDHSISDGPVVPKGTTLDHLAGRLAAGGSDAV
VVHKGSVRHISPERFAAMSLIIHLNASTSRALDPNAKYVVAGVEEALRLGADAVSVHVNL
GSDDEREQIGDLGRIADACDRWNLPLLAMVYPRGPRITDPRDPEMVAHAVTIAADLGADL
VKTVFLGSTAEMLDLTAACPVPVLVAGGPALDKEEDVLAYVRDALAGGAGGVAMGRNIFQ
AADPRRLAAKVARLVHHFPEQHFGTGPFAGGDARLDGERLTPHHLDDTHLDPAHPDHPRL
DDSRLDVSTGGPHHDGRQTVLA
NT seq 969 nt   +upstreamnt  +downstreamnt
atgacctcatacggccacttcgcccggtcgctgcggctgcggcggctctaccgccacagc
actgccggcctgatgatcacccctctcgaccattcgatcagtgacggtcccgtggtgccc
aagggcacgacgctcgaccacctcgccggccggctcgcggccggcggttcggacgccgtc
gtcgtgcacaagggcagtgtgcggcacatctctccggagcggttcgccgccatgtcgctg
atcatccatctgaacgcgagcaccagccgggcgctcgacccgaacgccaagtacgtcgtg
gccggggtcgaggaggcactccgcctcggcgcggacgcggtgagcgtccacgtcaacctc
ggctccgacgacgagcgggagcagatcggcgacctgggcaggatcgccgacgcctgcgac
cgctggaacctgccgctgctcgccatggtgtatccgcgcgggccgcggatcaccgatccc
cgggacccggagatggtcgcgcacgccgtgacgatcgccgccgacctgggggccgacctg
gtcaagaccgtgttcctggggtcgaccgcggagatgctcgacctcaccgcggcctgtccg
gtcccggtcctcgtcgccgggggccccgccctcgacaaggaggaggacgtgctcgcgtac
gtacgcgacgcgctggccggcggcgcggggggagtcgccatgggacgcaacatcttccag
gccgccgacccgcggcggctggcggcgaaggtcgcccggctggtccaccacttccccgaa
cagcacttcggtaccggcccgttcgccggcggcgacgcacggctcgacggcgaacgcctc
accccgcaccacctggacgacacgcacctcgaccccgcgcatcccgaccatccacgcctc
gacgactcacgtctcgacgtttcgacaggaggtccgcatcatgacggacgccaaactgtg
ctggcttga

DBGET integrated database retrieval system