KEGG   Streptococcus pyogenes HSC5 (serotype M14): L897_00945Help
Entry
L897_00945        CDS       T02743                                 

Definition
(GenBank) Nicotine adenine dinucleotide glycohydrolase (NADGH) SPN
  KO
K18153  NAD+ glycohydrolase [EC:3.2.2.5]
Organism
spyh  Streptococcus pyogenes HSC5 (serotype M14)
Pathway
spyh00760  Nicotinate and nicotinamide metabolism
spyh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spyh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    L897_00945
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:spyh00537]
    L897_00945
Enzymes [BR:spyh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.5  NAD+ glycohydrolase
     L897_00945
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:spyh00537]
 Enzymes
  L897_00945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NADase_NGA
Motif
Other DBs
NCBI-ProteinID: AGQ27060
LinkDB All DBs
Structure
PDB: 

Position
155142..156506
Genome map
AA seq 454 aa AA seqDB search
MVYMRNKKVTLAHIVAKTSVAIALAGAMGSSLLANSTTYAVSGKENKKSDVKYETTKVME
ANATSSKEDNHVMHTLDGSMSTVWEENSPGGGVGEVLSYKFASPMHIGRILIVNGDTSSK
ENYYKKNRIAKADVKYYNRNKLVLFQKIELGDTYTKKPHHIEIDKKLDVDRIDIEVTEVH
QGQNKDILALSEVTFGNIERDIFEKKFKEIKDKWVTDKQADEFIETADKYADKAVQMSAV
ASRAEYYRMYVSRKYHYKKEFVEKLKQVYKESGASHVTSKKDVMLAFDDAKKKSTIGRQE
NGLFVTSFAEDMALLFTDQGKLKSADQIENIKDVDSGKYSDGVYQYEYDSELTKNIDKLG
YIRTASGDTPGANSLNVPGCQTWSGKHIENSESELIFPSISVKDLKSKAVLAEIDAKGYF
EIIDPTIIAPNGDHKKVTGRFKIKKMQDRMQDRK
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
gtggtttacatgagaaacaaaaaagtaacattagctcatattgtcgcaaagacaagtgtt
gctattgctttggctggagcaatgggtagcagtttattagctaacagcacaacgtacgct
gttagtggcaaagaaaataaaaaaagcgatgtcaaatatgaaacgaccaaagttatggaa
gctaacgcaacttcctctaaagaagacaatcatgtcatgcacacattagacggctcaatg
agtactgtctgggaggaaaattcacctggtggtggtgttggtgaggtactttcctacaag
tttgcgtccccgatgcatattgggagaattttaattgttaatggagatacatctagcaag
gagaattactacaagaaaaatagaattgcaaaggctgatgttaaatactataacaggaat
aaattggtcctctttcaaaaaattgaattaggcgacacctacactaaaaaaccgcatcac
attgagattgataaaaaattagatgttgatcgtattgatattgaggtaacagaggtccat
cagggacaaaacaaggatattttagccttgtcagaggtcacttttggcaatatagaacgc
gatatttttgaaaaaaagtttaaagaaattaaagataaatgggtaacagataaacaagca
gatgagtttattgaaactgccgacaagtatgctgataaagctgttcagatgtctgctgtt
gcgtcacgtgctgagtattaccggatgtacgttagccgcaaataccactacaaaaaagag
tttgttgaaaaactaaaacaagtctacaaagaaagcggagcttcccacgttacaagcaaa
aaagatgtgatgttagcttttgacgatgctaaaaaaaagtcaacgattggtcgacaagaa
aacggtctttttgtgacaagttttgctgaagatatggcattgctctttactgatcaaggt
aagttaaaatcagctgaccaaattgaaaatataaaagatgtcgatagcggaaaatatagc
gatggggtttatcaatatgagtacgattctgaactaacaaaaaacattgataagctaggc
tatatccgaacagctagcggagatactcctggagcaaattcgctcaacgttcctggttgc
caaacgtggtcaggaaaacacattgaaaattcagaaagtgaattaattttcccatcgatt
agtgttaaagatctaaaatctaaagctgttttagcagagattgatgccaaaggctatttt
gaaattattgatcctaccatcattgctccaaatggtgaccataaaaaagtaactggtcgc
ttcaaaattaagaaaatgcaagatagaatgcaagataggaagtaa

DBGET integrated database retrieval system