KEGG   Sus scrofa (pig): 100144492
Entry
100144492         CDS       T01009                                 

Gene name
CDK4
Definition
(RefSeq) cyclin-dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01522  Endocrine resistance
ssc04110  Cell cycle
ssc04115  p53 signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04218  Cellular senescence
ssc04530  Tight junction
ssc04660  T cell receptor signaling pathway
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc04934  Cushing syndrome
ssc05160  Hepatitis C
ssc05162  Measles
ssc05163  Human cytomegalovirus infection
ssc05164  Influenza A
ssc05165  Human papillomavirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05169  Epstein-Barr virus infection
ssc05200  Pathways in cancer
ssc05203  Viral carcinogenesis
ssc05212  Pancreatic cancer
ssc05214  Glioma
ssc05218  Melanoma
ssc05219  Bladder cancer
ssc05220  Chronic myeloid leukemia
ssc05222  Small cell lung cancer
ssc05223  Non-small cell lung cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100144492 (CDK4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100144492 (CDK4)
   04115 p53 signaling pathway
    100144492 (CDK4)
   04218 Cellular senescence
    100144492 (CDK4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100144492 (CDK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100144492 (CDK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100144492 (CDK4)
   05203 Viral carcinogenesis
    100144492 (CDK4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100144492 (CDK4)
   05225 Hepatocellular carcinoma
    100144492 (CDK4)
   05214 Glioma
    100144492 (CDK4)
   05220 Chronic myeloid leukemia
    100144492 (CDK4)
   05218 Melanoma
    100144492 (CDK4)
   05219 Bladder cancer
    100144492 (CDK4)
   05224 Breast cancer
    100144492 (CDK4)
   05222 Small cell lung cancer
    100144492 (CDK4)
   05223 Non-small cell lung cancer
    100144492 (CDK4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100144492 (CDK4)
   04934 Cushing syndrome
    100144492 (CDK4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100144492 (CDK4)
   05160 Hepatitis C
    100144492 (CDK4)
   05164 Influenza A
    100144492 (CDK4)
   05162 Measles
    100144492 (CDK4)
   05163 Human cytomegalovirus infection
    100144492 (CDK4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100144492 (CDK4)
   05169 Epstein-Barr virus infection
    100144492 (CDK4)
   05165 Human papillomavirus infection
    100144492 (CDK4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100144492 (CDK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100144492 (CDK4)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100144492 (CDK4)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100144492 (CDK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like FTA2
Other DBs
NCBI-GeneID: 100144492
NCBI-ProteinID: NP_001116569
Ensembl: ENSSSCG00000025092
UniProt: P79432
LinkDB
Position
5
AA seq 303 aa
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFSPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKAEG
NPE
NT seq 912 nt   +upstreamnt  +downstreamnt
atggctacctcccggtatgaaccagtggcggagattggtgttggtgcctatgggaccgtg
tacaaagcacgggatccccacagtggccactttgtggccctcaagagcgtaagagtcccc
aatggaggaggtgctggagggggcctgcccatcagcacggttcgtgaagtggccttactg
cgccggctggaggctttcgagcatcccaatgttgtccggctgatggatgtctgtgccact
gcccgaactgatcgagagaccaaagtgaccctggtgtttgagcatgtggaccaagatcta
aggacatatctggacaaggcacccccaccaggcttgccggtggagaccatcaaggatctg
atgcgtcagtttctaagaggcctagatttccttcatgccaactgcatcgttcatcgagac
ctgaagccagagaacattctggttacaagtggtgggacagtcaagctggctgactttggc
ctggccagaatctacagctaccagatggcacttacacctgtggtggttacactctggtac
cgtgctccagaagttcttttgcagtctacgtatgcaacacctgtggacatgtggagcgtt
ggctgtatcttcgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagct
gaccagttaggcaaaatctttgacctgattgggctgcccccagaggatgactggccccga
gatgtgtctctaccccgaggagccttttcccccagagggccccgcccagtgcagtcggtg
gtacctgagatggaggagtctggagcacagctgctactggagatgctgacttttaaccca
cacaagcgaatctctgccttccgagccctgcagcactcttatctacataaggcagaaggt
aacccagagtga

DBGET integrated database retrieval system