KEGG   Streptomyces sp. MOE7: STRMOE7_04800Help
Entry
STRMOE7_04800     CDS       T05374                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro00071  Fatty acid degradation
stro00280  Valine, leucine and isoleucine degradation
stro00281  Geraniol degradation
stro00310  Lysine degradation
stro00360  Phenylalanine metabolism
stro00362  Benzoate degradation
stro00380  Tryptophan metabolism
stro00410  beta-Alanine metabolism
stro00627  Aminobenzoate degradation
stro00640  Propanoate metabolism
stro00650  Butanoate metabolism
stro00903  Limonene and pinene degradation
stro00930  Caprolactam degradation
stro01100  Metabolic pathways
stro01110  Biosynthesis of secondary metabolites
stro01120  Microbial metabolism in diverse environments
stro01130  Biosynthesis of antibiotics
stro01212  Fatty acid metabolism
Module
stro_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:stro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    STRMOE7_04800
   00650 Butanoate metabolism
    STRMOE7_04800
  09103 Lipid metabolism
   00071 Fatty acid degradation
    STRMOE7_04800
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STRMOE7_04800
   00310 Lysine degradation
    STRMOE7_04800
   00360 Phenylalanine metabolism
    STRMOE7_04800
   00380 Tryptophan metabolism
    STRMOE7_04800
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    STRMOE7_04800
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    STRMOE7_04800
   00281 Geraniol degradation
    STRMOE7_04800
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    STRMOE7_04800
   00627 Aminobenzoate degradation
    STRMOE7_04800
   00930 Caprolactam degradation
    STRMOE7_04800
Enzymes [BR:stro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     STRMOE7_04800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ARH89721
UniProt: A0A1W5XIN6
LinkDB All DBs
Position
1052539..1053297
Genome map
AA seq 252 aa AA seqDB search
MGVSTSRPEPGIAVVTMDFPPVNALPVQGWYALADAVRAAGRDPGVRCVVLTAEGRGFNA
GVDIKELQRDAAAGGRQALLGANRGCAEAFSAVYECAVPVVAAVHGFCLGGGIGLAGNAD
AIVASDEAVFGLPELDRGALGAATHLARLVPQHLMRALYYTSRTATADELRAHGSVWRVV
PRDRLGAAARELAGEIARKDGSLLRLAKAALNGIDPVDVHRSYRFEQGFTFEANLSGVAD
RVRDTFGQEART
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtctccacctcccggcccgaaccgggcatcgcggtcgtcaccatggacttccca
ccggtcaacgcccttcccgtgcagggctggtacgccctcgccgacgccgtgcgggcggcc
ggccgggaccccggcgtccgctgtgtcgtgctcaccgccgagggccgcggcttcaacgcc
ggggtggacatcaaggagctgcagcgggacgccgcggccggtggacggcaggcgctgctc
ggcgccaaccggggctgcgcggaggcgttctcggcggtgtacgagtgcgcggtgccggtc
gtcgccgcggtgcacgggttctgtctggggggcggaatcgggctggccgggaacgccgac
gcgatcgtggccagcgacgaggccgtcttcggcctgccggagctggaccggggcgcgctc
ggggccgccacccacctcgcccggctcgtcccccagcacctgatgcgcgcgctctactac
acctcgcgcaccgccaccgcggacgagctgcgggcacacggctcggtgtggcgcgtcgtc
ccccgggaccgactgggcgccgcggcaagggaattggccggcgagatcgcccggaaggac
ggctccctcctgcgcctcgccaaggccgcgctcaacggcatcgacccggttgacgtacac
cgcagctaccgcttcgagcagggcttcaccttcgaggcgaacctcagcggcgtcgccgac
cgggtacgcgacaccttcggccaggaggcccggacatga

KEGG   Streptomyces sp. MOE7: STRMOE7_04830Help
Entry
STRMOE7_04830     CDS       T05374                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro00071  Fatty acid degradation
stro00280  Valine, leucine and isoleucine degradation
stro00281  Geraniol degradation
stro00310  Lysine degradation
stro00360  Phenylalanine metabolism
stro00362  Benzoate degradation
stro00380  Tryptophan metabolism
stro00410  beta-Alanine metabolism
stro00627  Aminobenzoate degradation
stro00640  Propanoate metabolism
stro00650  Butanoate metabolism
stro00903  Limonene and pinene degradation
stro00930  Caprolactam degradation
stro01100  Metabolic pathways
stro01110  Biosynthesis of secondary metabolites
stro01120  Microbial metabolism in diverse environments
stro01130  Biosynthesis of antibiotics
stro01212  Fatty acid metabolism
Module
stro_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:stro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    STRMOE7_04830
   00650 Butanoate metabolism
    STRMOE7_04830
  09103 Lipid metabolism
   00071 Fatty acid degradation
    STRMOE7_04830
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STRMOE7_04830
   00310 Lysine degradation
    STRMOE7_04830
   00360 Phenylalanine metabolism
    STRMOE7_04830
   00380 Tryptophan metabolism
    STRMOE7_04830
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    STRMOE7_04830
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    STRMOE7_04830
   00281 Geraniol degradation
    STRMOE7_04830
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    STRMOE7_04830
   00627 Aminobenzoate degradation
    STRMOE7_04830
   00930 Caprolactam degradation
    STRMOE7_04830
Enzymes [BR:stro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     STRMOE7_04830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ARH89726
UniProt: A0A1W5XIQ6
LinkDB All DBs
Position
1058150..1059034
Genome map
AA seq 294 aa AA seqDB search
MPAAQDEEPVRYERHGPLATVTMNRPDYRNAQNSAMTYALDRAFYRAADDNEVKVIVLAG
AGRHFSAGHDIGTPERDAHLPFDRTAGLWWDHSDKAGAESRFARESEVYLGMCRRWRELP
KPVLASVQGACVAGGLMLAWVCDLIIASEDAFFADPVVRMGIPGVEFFAHPWVMPPRIAK
EFLYTGDRMTARRAYEVGMVNRVVPRAELTLRTRELALRIAEMPRLGLALTKRAVNQAED
LQGLHTGLDSVFGLHHLAHAHNAETAADPLGGMDIRAMRQHSADRAPSAREAGA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcccgctgcccaggacgaggagcccgtgcgctacgagcgccacggtccgctcgccacc
gtcaccatgaaccgcccggactaccgcaacgcccagaactccgcgatgacgtacgccctc
gaccgcgccttctaccgcgccgcggacgacaacgaggtcaaggtcatcgtgctggccggc
gcgggccggcacttctccgccggccatgacatcggcacccccgagcgcgacgcgcacctc
cccttcgaccgcaccgccggtctgtggtgggaccactccgacaaggcgggcgcggagagc
aggttcgcccgcgagtccgaggtctatctgggcatgtgccgccgctggcgcgagctgccc
aagccggtgctcgcctcggtccagggggcctgtgtggcgggcgggttgatgctcgcctgg
gtctgcgacctgatcatcgcctccgaggacgcgttcttcgccgacccggtggtacggatg
ggcatccccggcgtcgagttcttcgcccacccgtgggtgatgccgccgcggatcgccaag
gagttcctctacaccggcgaccggatgaccgcccggcgcgcgtacgaggtaggcatggtc
aaccgcgtcgtaccgcgtgccgaactgacgcttcgcacgcgcgagttggcgctgcgcatc
gccgagatgccgcggctcgggctggccctgaccaagcgggcggtcaaccaggccgaggac
cttcagggcctgcacaccggcctggactcggtgttcggcctgcaccacctcgcgcacgcg
cacaacgccgagaccgccgcggacccgctgggcggcatggacatccgcgcgatgcgacag
cactccgcggaccgtgcgccctcggcacgggaggcgggggcctga

KEGG   Streptomyces sp. MOE7: STRMOE7_06590Help
Entry
STRMOE7_06590     CDS       T05374                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro00071  Fatty acid degradation
stro00280  Valine, leucine and isoleucine degradation
stro00281  Geraniol degradation
stro00310  Lysine degradation
stro00360  Phenylalanine metabolism
stro00362  Benzoate degradation
stro00380  Tryptophan metabolism
stro00410  beta-Alanine metabolism
stro00627  Aminobenzoate degradation
stro00640  Propanoate metabolism
stro00650  Butanoate metabolism
stro00903  Limonene and pinene degradation
stro00930  Caprolactam degradation
stro01100  Metabolic pathways
stro01110  Biosynthesis of secondary metabolites
stro01120  Microbial metabolism in diverse environments
stro01130  Biosynthesis of antibiotics
stro01212  Fatty acid metabolism
Module
stro_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:stro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    STRMOE7_06590
   00650 Butanoate metabolism
    STRMOE7_06590
  09103 Lipid metabolism
   00071 Fatty acid degradation
    STRMOE7_06590
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STRMOE7_06590
   00310 Lysine degradation
    STRMOE7_06590
   00360 Phenylalanine metabolism
    STRMOE7_06590
   00380 Tryptophan metabolism
    STRMOE7_06590
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    STRMOE7_06590
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    STRMOE7_06590
   00281 Geraniol degradation
    STRMOE7_06590
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    STRMOE7_06590
   00627 Aminobenzoate degradation
    STRMOE7_06590
   00930 Caprolactam degradation
    STRMOE7_06590
Enzymes [BR:stro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     STRMOE7_06590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ARH90018
UniProt: A0A1W5XJI7
LinkDB All DBs
Position
complement(1447650..1448450)
Genome map
AA seq 266 aa AA seqDB search
MDGTEHLTVERQGATLVLTLNRPEAKNALSLPMLVGLYDGWTAADEDDTIRSIVLTGAGG
TFCAGMDLKALAGDGMAGEHYRDRLRADPDLHWKAMLRHHRPRKPVIAAVEGHCVAGGTE
ILQGTDIRVAGESATFGLYEVRRGLFPIGGSTVRLPRQIPRTHALEMLLTGRPYPAPEAA
RIGLIGHVVPDGGALEKALEIAGQINACGPLAVEAVKASVYEAAELTEADGLKAELARGW
PVFDTADAKEGARAFAEKRPPVYRRA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggacggaaccgaacatctcaccgtggagcgtcagggcgcgacactcgtgctcaccctc
aaccggccggaggcgaagaacgccctctcgctgccgatgctggtgggcctgtacgacggc
tggaccgccgccgacgaggacgacaccatccggtccatcgtcctcaccggcgccggcggc
accttctgcgccgggatggacctcaaggcgctggcgggcgacggcatggccggcgagcac
taccgcgaccggctgcgcgccgaccccgacctgcactggaaggcgatgctgcgccaccac
cgcccgcgcaaacccgtcatcgccgccgtcgagggccactgcgtcgccggcggcaccgag
atcctccagggcaccgacatccgcgtcgccggcgagagcgccaccttcgggctctacgag
gtccggcgcggcctgttccccatcggcggctccaccgtccgcctgccccgccagatcccg
cgcacccacgccctggagatgctgctcaccggccggccctacccggcgcccgaggccgcc
cgcatcggcctgatcggccatgtcgtgccggacggcggcgccctggagaaggcgctggag
atcgccggacagatcaacgcctgcgggccgctcgccgtcgaggccgtcaaggcttccgtc
tacgaggccgccgagctgaccgaggccgacgggctcaaggccgaactcgcccgcggctgg
cccgtcttcgacaccgccgacgccaaggaaggcgcccgggccttcgcggagaagcgccca
cccgtctaccggcgcgcctga

KEGG   Streptomyces sp. MOE7: STRMOE7_23430Help
Entry
STRMOE7_23430     CDS       T05374                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro00071  Fatty acid degradation
stro00280  Valine, leucine and isoleucine degradation
stro00281  Geraniol degradation
stro00310  Lysine degradation
stro00360  Phenylalanine metabolism
stro00362  Benzoate degradation
stro00380  Tryptophan metabolism
stro00410  beta-Alanine metabolism
stro00627  Aminobenzoate degradation
stro00640  Propanoate metabolism
stro00650  Butanoate metabolism
stro00903  Limonene and pinene degradation
stro00930  Caprolactam degradation
stro01100  Metabolic pathways
stro01110  Biosynthesis of secondary metabolites
stro01120  Microbial metabolism in diverse environments
stro01130  Biosynthesis of antibiotics
stro01212  Fatty acid metabolism
Module
stro_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:stro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    STRMOE7_23430
   00650 Butanoate metabolism
    STRMOE7_23430
  09103 Lipid metabolism
   00071 Fatty acid degradation
    STRMOE7_23430
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STRMOE7_23430
   00310 Lysine degradation
    STRMOE7_23430
   00360 Phenylalanine metabolism
    STRMOE7_23430
   00380 Tryptophan metabolism
    STRMOE7_23430
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    STRMOE7_23430
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    STRMOE7_23430
   00281 Geraniol degradation
    STRMOE7_23430
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    STRMOE7_23430
   00627 Aminobenzoate degradation
    STRMOE7_23430
   00930 Caprolactam degradation
    STRMOE7_23430
Enzymes [BR:stro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     STRMOE7_23430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ARH92741
UniProt: A0A1W5XS72
LinkDB All DBs
Position
5269516..5270286
Genome map
AA seq 256 aa AA seqDB search
MTDAPVTPLVSRSHERGITTLTLDSPHNRNALSARLVAELHQALADAAADDATRAVVLTH
TGNTFCAGADLSEATSGAAKDGPLGLARLLRTLVELPRPVVARVTGHVRAGGLGLLGACD
ISAAGPEATFAFTEARLGLAPAVISLPLLPRLDPRAAGRYYLTGETFRAAEAARIGLVTL
AAEDVDAGLAPVLEGLRKGSPQGLAASKKLVTAEVLAAFDRDTDALAERSAQLFGSAEAR
EGMTAFLERRAPSWAR
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcacccgtgaccccgctggtgtcccgctcccacgagcgcggcatcaccacc
ctcaccctggactccccgcacaaccgcaacgccctctccgcccgcctggtcgccgaactg
caccaggcgctcgcggacgccgcggccgacgacgccacccgggccgtcgtgctcacccac
accggcaacaccttctgcgccggggcggacctgtccgaggccacctcgggggcggcgaag
gacggcccgctggggctggcccggctgctgcggaccctcgtcgagctgccccggccggtc
gtcgcccgggtcaccggccacgtccgggccggcggcctcggactgctcggcgcctgcgac
atctccgcggccggcccggaggccaccttcgccttcaccgaggcccgcctcggcctcgcg
cccgccgtcatctcgctgccgctgctgccgcggctggacccgcgcgccgccggccgctac
tacctgaccggcgagaccttccgcgccgcggaggcggcccggatcgggctggtcacgctc
gccgccgaggacgtcgacgccggcctcgcccccgtactggagggactgcgcaagggctcc
ccgcaggggctggccgcgtcgaagaagctggtcaccgcggaggtgctggccgccttcgac
cgggacaccgacgcgctcgccgaacggtccgcgcagctcttcggctccgccgaggcccgc
gagggcatgaccgccttcctggagcgacgggccccgtcatgggcgcgctga

KEGG   Streptomyces sp. MOE7: STRMOE7_31700Help
Entry
STRMOE7_31700     CDS       T05374                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro00071  Fatty acid degradation
stro00280  Valine, leucine and isoleucine degradation
stro00281  Geraniol degradation
stro00310  Lysine degradation
stro00362  Benzoate degradation
stro00380  Tryptophan metabolism
stro00410  beta-Alanine metabolism
stro00640  Propanoate metabolism
stro00650  Butanoate metabolism
stro00903  Limonene and pinene degradation
stro00930  Caprolactam degradation
stro01100  Metabolic pathways
stro01110  Biosynthesis of secondary metabolites
stro01120  Microbial metabolism in diverse environments
stro01130  Biosynthesis of antibiotics
stro01200  Carbon metabolism
stro01212  Fatty acid metabolism
Module
stro_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:stro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    STRMOE7_31700
   00650 Butanoate metabolism
    STRMOE7_31700
  09103 Lipid metabolism
   00071 Fatty acid degradation
    STRMOE7_31700
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STRMOE7_31700
   00310 Lysine degradation
    STRMOE7_31700
   00380 Tryptophan metabolism
    STRMOE7_31700
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    STRMOE7_31700
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    STRMOE7_31700
   00281 Geraniol degradation
    STRMOE7_31700
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    STRMOE7_31700
   00930 Caprolactam degradation
    STRMOE7_31700
Enzymes [BR:stro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     STRMOE7_31700
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     STRMOE7_31700
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     STRMOE7_31700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 DAO F420_oxidored Pyr_redox_2 NAD_Gly3P_dh_N Sacchrp_dh_NADP adh_short_C2 NAD_binding_8 2-Hacid_dh_C UDPG_MGDP_dh_N GIDA
Motif
Other DBs
NCBI-ProteinID: ARH94101
UniProt: A0A1W5XW47
LinkDB All DBs
Position
7216130..7218331
Genome map
AA seq 733 aa AA seqDB search
MSESAALTIRWEQDETGIVTLVLDDPGQSANTMNNAFKTSLTAVADRLEAEKDSIRGIIF
TSAKKTFFAGGDLRDLIAVTPAQAQRAFESGNGIKRDLRRIETLGKPVVAAINGAALGGG
YEIALACHHRVALDTPGTKIGLPEVTLGLLPAAGGVTRTVRLLGIADALLKVLLQGTQYS
APRAKEAGLIHDVAATPEELLAKARAFVDEHPESQQPWDVKGYRIPGGTPAQPKFAANLP
AFPANLKKQLNGAPYPAPRNILAAAVEGSQVDFETAQTVEARYFVELVTGQISKNMIQAF
FFDLQAVNSGANRPKDIEPRKVEKVAVLGAGMMGAGIAYACAKAGIQVVLKDVTPEAAQK
GKAYAEGLLAKALSRGRTTEQKRDELLARITPTAEPNDLAGCDAVIEAVFEDVALKRKVF
KEIQHIVAPDALLCSNTSTLPITLLAEGVERDQDFIGLHFFSPVDKMPLVEIIKGGRTGD
EALARAFDLVRQIKKTPIVVNDSRGFFTSRVIGHFINEGVAMVGEGLDPASVEQAAAQAG
YPAKVLSLMDELTLTLPRKIREETRRAAEEAGGTWQPHPADEVIDRMVDEFGRPGRSGGA
GFYEYGEDGKRAGLWPGLREHFAKEGAGIPFRDMQERMLFSEALDTVRCFEEGVLTSVAD
ANIGSIFGIGFPGWTGGVLQYINGYQGGPEREDLVGLPGFVARARELQAAYGDRFAPPAL
LIDKAEKGEKFSD
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaatccgccgctttgaccatccgctgggaacaggacgagaccggcatcgtcacc
ctggtcctggacgaccccggccagtccgccaacaccatgaacaatgccttcaagacctct
ctcaccgcggtcgccgaccgcctggaggccgagaaggacagcatccgcggcatcatcttc
acctccgcgaagaagaccttcttcgccggcggcgacctgcgcgacctgatcgccgtcacc
cccgcccaggcccagcgggccttcgagtcgggcaacggcatcaagcgcgacctgcgccgc
atcgaaacgctcggcaagcccgtcgtcgccgccatcaacggcgcggcgctgggcggcggt
tacgagatcgcgctcgcctgccaccaccgcgtcgccctcgacacccccggcaccaagatc
ggcctgcccgaggtcaccctcggcctgctgcccgccgccggcggtgtcacccgcacggtc
cggctgctcggcatcgccgacgcgctgctgaaggtgctgctccagggcacccagtacagc
gccccgcgcgccaaggaagccgggctgatccacgacgtcgcggccacccccgaggaactg
ctcgccaaggcccgcgccttcgtcgacgagcaccccgagtcccagcagccctgggacgtg
aaggggtaccgcatccccggcggcacgcccgcccagccgaagttcgcggccaacctcccg
gcgttccccgccaacctcaagaagcagctgaacggcgcgccgtacccggcgccgcgcaac
atcctcgccgcggccgtcgagggctcccaggtcgacttcgagaccgcgcagaccgtcgag
gcgcggtacttcgtcgagctggtgaccggccagatctccaagaacatgatccaggcgttc
ttcttcgacctccaggccgtcaactccggcgccaaccgccccaaggacatcgagccccgc
aaggtcgagaaggtcgcggtcctcggcgccggcatgatgggcgcgggcatcgcctacgcc
tgcgccaaggccggcatccaggtcgtcctcaaggacgtcaccccggaagcggcccagaag
ggcaaggcgtacgcggaggggctgctcgccaaggcgctctcccggggccgtacgaccgag
cagaagcgcgacgagctgctggcgcgcatcacgcccaccgccgagcccaacgacctcgcg
ggctgcgacgccgtcatcgaggcggtcttcgaggacgtcgccctcaagcgcaaggtgttc
aaggagatccagcacatcgtcgcgcccgacgcgctgctgtgctcgaacacctcgaccctc
cccatcacgctgctggccgagggcgtggagcgcgaccaggacttcatcgggctgcacttc
ttctcgccggtcgacaagatgccgctggtggagatcatcaagggcgggcggaccggcgac
gaggcgctggcccgcgccttcgacctggtccgccagatcaagaagaccccgatcgtcgtc
aatgactcccgcggcttcttcacctcccgggtcatcggccacttcatcaacgaaggcgtg
gcgatggtcggcgagggcctcgacccggcctccgtcgagcaggccgccgcccaggccggc
tacccggccaaggtgctgtcgctgatggacgagctgaccctgaccctgccccgcaagatc
cgcgaggagaccaggcgggcggccgaggaggccggcggcacctggcagccgcacccggcc
gacgaggtcatcgaccggatggtcgacgagttcgggcgccccggccgcagcggcggtgcc
ggcttctacgagtacggcgaggacggcaagcgcgccggcctgtggccgggcctgcgcgag
cacttcgccaaggagggggccggcatccccttcagggacatgcaggagcggatgctgttc
tccgaggcactggacaccgtccgctgcttcgaggagggcgtcctcacctctgtcgccgac
gccaacatcggctccattttcgggatcggcttcccgggctggaccggcggtgtgctccag
tacatcaacggctaccagggcgggccggagcgggaggacctggtcggtctgcccgggttc
gtggcccgcgcccgtgagctgcaggcggcctacggcgaccggttcgccccgcccgcgctg
ctgatcgacaaggccgaaaagggcgagaagttcagcgactga

KEGG   Streptomyces sp. MOE7: STRMOE7_32160Help
Entry
STRMOE7_32160     CDS       T05374                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro00071  Fatty acid degradation
stro00280  Valine, leucine and isoleucine degradation
stro00281  Geraniol degradation
stro00310  Lysine degradation
stro00360  Phenylalanine metabolism
stro00362  Benzoate degradation
stro00380  Tryptophan metabolism
stro00410  beta-Alanine metabolism
stro00627  Aminobenzoate degradation
stro00640  Propanoate metabolism
stro00650  Butanoate metabolism
stro00903  Limonene and pinene degradation
stro00930  Caprolactam degradation
stro01100  Metabolic pathways
stro01110  Biosynthesis of secondary metabolites
stro01120  Microbial metabolism in diverse environments
stro01130  Biosynthesis of antibiotics
stro01212  Fatty acid metabolism
Module
stro_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:stro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    STRMOE7_32160
   00650 Butanoate metabolism
    STRMOE7_32160
  09103 Lipid metabolism
   00071 Fatty acid degradation
    STRMOE7_32160
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STRMOE7_32160
   00310 Lysine degradation
    STRMOE7_32160
   00360 Phenylalanine metabolism
    STRMOE7_32160
   00380 Tryptophan metabolism
    STRMOE7_32160
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    STRMOE7_32160
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    STRMOE7_32160
   00281 Geraniol degradation
    STRMOE7_32160
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    STRMOE7_32160
   00627 Aminobenzoate degradation
    STRMOE7_32160
   00930 Caprolactam degradation
    STRMOE7_32160
Enzymes [BR:stro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     STRMOE7_32160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ARH94171
UniProt: A0A1W5XWB5
LinkDB All DBs
Position
complement(7323968..7324732)
Genome map
AA seq 254 aa AA seqDB search
MAVRIERAGPVTTVVLSRPAARNAVDGPTARHLADAFREFDADDTARVAVLWGEGGTFCA
GADLKAIGTGRGNRVAEDGDGPMGPTRMRLSKPVIAAVAGHAVAGGLELALWCDLRIAEE
DAVFGVFCRRWGVPLIDGGTVRLPRLIGASRASDLVLTGRPVPAAEALAIGLANRVVPTG
TARAEAELLAAEIARFPQACLRSDRASLLEQEGLDEATALAGELRHGRAVLAEAREGAAR
FAAGAGRHGAPDPA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgcggatcgagcgggccgggccggtgacgacggtggtgctgtcccggccggcg
gcccgcaacgcggtggacggcccgaccgcgcgccacctcgccgacgccttccgggagttc
gacgcggacgacacggcgcgggtagcggtgctgtggggcgagggcgggacgttctgcgcg
ggtgccgacctcaaggcgatcggcaccggacgcggcaaccgtgtcgcggaggacggcgac
ggcccgatggggcccacccgcatgcggctgtccaagccggtgatcgccgcggtggcggga
cacgccgtggcaggcggcctggaactggccctctggtgcgacctgcggatcgccgaggag
gacgcggtcttcggggtgttctgccggcggtggggcgtgccgctgatcgacggcggtacg
gtccggctgccgcgcctgatcggtgcgagccgggcgagtgacctggtgctgacgggacgt
ccggtgccggcggcggaggccctcgccatcgggctggcgaaccgcgtggtgccgaccggg
acggcgcgcgcggaggcggagctgctggccgcggagatcgcccgcttcccgcaggcgtgt
ctgcgcagcgaccgggcctccctgctggagcaggagggcctggacgaggcgaccgcgctg
gccggcgaactccggcacggccgggcggtgctggccgaggcgagggagggcgcggcccgc
ttcgccgcgggcgccgggcggcacggcgcgccggaccccgcgtag

KEGG   Streptomyces sp. MOE7: STRMOE7_32460Help
Entry
STRMOE7_32460     CDS       T05374                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro00071  Fatty acid degradation
stro00280  Valine, leucine and isoleucine degradation
stro00281  Geraniol degradation
stro00310  Lysine degradation
stro00360  Phenylalanine metabolism
stro00362  Benzoate degradation
stro00380  Tryptophan metabolism
stro00410  beta-Alanine metabolism
stro00627  Aminobenzoate degradation
stro00640  Propanoate metabolism
stro00650  Butanoate metabolism
stro00903  Limonene and pinene degradation
stro00930  Caprolactam degradation
stro01100  Metabolic pathways
stro01110  Biosynthesis of secondary metabolites
stro01120  Microbial metabolism in diverse environments
stro01130  Biosynthesis of antibiotics
stro01212  Fatty acid metabolism
Module
stro_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:stro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    STRMOE7_32460
   00650 Butanoate metabolism
    STRMOE7_32460
  09103 Lipid metabolism
   00071 Fatty acid degradation
    STRMOE7_32460
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STRMOE7_32460
   00310 Lysine degradation
    STRMOE7_32460
   00360 Phenylalanine metabolism
    STRMOE7_32460
   00380 Tryptophan metabolism
    STRMOE7_32460
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    STRMOE7_32460
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    STRMOE7_32460
   00281 Geraniol degradation
    STRMOE7_32460
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    STRMOE7_32460
   00627 Aminobenzoate degradation
    STRMOE7_32460
   00930 Caprolactam degradation
    STRMOE7_32460
Enzymes [BR:stro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     STRMOE7_32460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ARH94223
UniProt: A0A1W5XWJ1
LinkDB All DBs
Position
7398011..7398811
Genome map
AA seq 266 aa AA seqDB search
MSSTPLPGTPGTTADVVRTERIGTTLLITLDRPRARNAVDAATAAQLAHAVDELAADDTL
RAGVLTGAQGTFSAGMDLKAALAGESPDVPGRGFGGLAEAPAGKPLIAAVEGWAMGGGFE
LALACDLIVAAEDARFGLPEVKRGLIAAGGGAIRLPKRIPYHLAMELLLTGEPISGEQAG
RLGIANRVVPAGQTVRAALELAEGLAHNAPLALAAVKRIARAADGVPEPDAFAAQRTELA
ALAASADVREGMTAFAERRSPVWQGK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcacgcccctgcccggcacccccgggaccaccgccgacgtcgtccgcaccgag
cggatcggtaccacgctgctcatcaccctcgaccggccccgcgcccggaacgcggtcgat
gccgcgaccgccgcacaactcgcccacgcggtggacgagttggcggcggacgacaccctg
cgggccggggtgctgacgggtgcgcagggcaccttcagcgccggaatggacctcaaggcc
gcgctggccggcgagtcgcccgacgtcccgggccggggcttcggcggcctcgccgaggcc
ccggccggcaagccgctgatcgccgccgtcgagggctgggcgatgggcggcggcttcgaa
ctcgccctggcctgcgacctgatcgtggcggcggaggacgcccggttcggtctgcccgag
gtcaagcgcggcctcatcgcggccggcggcggcgcgatccggctgcccaagcgcatcccg
taccacctggccatggagctgctgctgaccggcgagccgatctccggcgagcaggccggc
cggctcggcatcgccaaccgggtggtgcccgccgggcagaccgtccgggccgcactggag
ctggccgaagggctcgcgcacaacgccccgctggccctcgccgccgtgaagcggatcgcc
cgcgccgccgacggggtgcccgagcccgacgcgttcgccgcccagcgcacggagctggcc
gcgctggccgcctcggccgacgtgcgggagggcatgaccgccttcgccgaacgccgcagc
cccgtctggcagggcaagtag

DBGET integrated database retrieval system