KEGG   Streptomyces sp. MOE7: STRMOE7_04805Help
Entry
STRMOE7_04805     CDS       T05374                                 

Definition
(GenBank) acyl CoA--acetate/3-ketoacid CoA transferase subunit alpha
  KO
K01039  glutaconate CoA-transferase, subunit A [EC:2.8.3.12]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro00643  Styrene degradation
stro00650  Butanoate metabolism
stro01100  Metabolic pathways
stro01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:stro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    STRMOE7_04805
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    STRMOE7_04805
Enzymes [BR:stro01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.12  glutaconate CoA-transferase
     STRMOE7_04805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: ARH89722
UniProt: A0A1W5XIN0
LinkDB All DBs
Position
1053294..1054136
Genome map
AA seq 280 aa AA seqDB search
MTDKTMTPEDVVGRLRSGMTLGIGGWGSRRKPMALVRALLRSGVTDLTVISYGGPDVGLL
VAAGRIRKLVAPFATLDSIPLEPHFRAARQRGAFELTEVDEAMFMWGLRAAAHRLPFLPV
RAGIGSDVMRVNPGLRTVTSPYEDEETLVAMPALRMDAALVHVNRADRLGNSQYLGPDPY
FDDLFCEAADTAYVSCEALVDGFPAAALQTLLVKRHTVTGVVETPHGAHFTSCVPDYGRD
EAFQKLYATTPWPEFAARFLSGPDEKSYRSAVDAWHEEQR
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaagaccatgacgcccgaggacgtggtcggccgcctgcgcagcggcatgacg
ctcggcatcggcggctggggctcgcgccgcaaaccgatggccctggtgcgggcgctgctg
cggtccggcgtcacggatctgaccgtgatctcgtacggcgggccggacgtgggcctgctc
gtcgccgcgggccggatccgcaagctcgtcgccccgttcgcgacgctcgactcgatcccg
ctcgaaccgcacttccgcgcggcccggcagcgcggggcgttcgagctgacggaggtcgac
gaggcgatgttcatgtgggggctgcgggccgccgcccaccggctgccgttcctgcccgta
cgggccggcatcgggtcggacgtgatgcgcgtcaaccccggtctgcggacggtcacctca
ccctacgaggacgaagagacgctggtcgccatgccggccctgcgcatggacgcggcactg
gtccacgtcaaccgcgcggaccggctgggcaacagccaatacctgggccccgatccgtac
ttcgacgacctgttctgcgaggccgcggacaccgcgtacgtctcctgcgaggcgctggtg
gacggtttcccggccgctgcgctgcagacgctgctggtcaagcggcacacggtcacgggt
gtcgtcgagacgccgcacggcgcgcacttcacctcgtgcgtccccgactacggccgggac
gaggcgttccagaagctgtacgcgaccacgccctggcccgagttcgcggcgcgcttcctg
tccggtccggacgagaagtcctaccggtcggccgtcgacgcctggcacgaggagcagcga
tga

DBGET integrated database retrieval system