KEGG   Tribolium castaneum (red flour beetle): 107397827
Entry
107397827         CDS       T01046                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:tca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107397827
SSDB
Motif
Pfam: CDI SCP-1
Other DBs
NCBI-GeneID: 107397827
NCBI-ProteinID: XP_015834937
UniProt: D1ZZI0
LinkDB
Position
LG4
AA seq 87 aa
MTSQKPPESEGATVMKPEPPTSQNGNNNVRRRLFQSEENENVHPDLIDLLEESRQRAAEK
WNFDFVNEVPLEGDWEWERVPPTPPTD
NT seq 264 nt   +upstreamnt  +downstreamnt
atgacgagccaaaagccgccagaaagtgaaggtgccactgtcatgaaaccagaaccccct
acgtctcaaaatggtaataacaacgttagacggcgattatttcaaagtgaggaaaatgaa
aatgttcatcctgatttgatcgatttgttggaggaaagtagacaaagggctgcagagaaa
tggaactttgattttgtaaatgaagtgcccttggaaggagactgggagtgggaaagggtt
ccccctaccccaccaacagactga

DBGET integrated database retrieval system