Tribolium castaneum (red flour beetle): 655935 Help Entry 655935            CDS       T01046                                  Name (RefSeq) RING-box protein 1A   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism tca  Tribolium castaneum (red flour beetle) Pathway tca03420   Nucleotide excision repair tca04120   Ubiquitin mediated proteolysis tca04141   Protein processing in endoplasmic reticulum tca04310   Wnt signaling pathway tca04341   Hedgehog signaling pathway - fly tca04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:tca00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     655935    04120 Ubiquitin mediated proteolysis     655935   09124 Replication and repair    03420 Nucleotide excision repair     655935  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     655935    04341 Hedgehog signaling pathway - fly     655935    04350 TGF-beta signaling pathway     655935  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:tca04121]     655935    03400 DNA repair and recombination proteins [BR:tca03400]     655935 Enzymes [BR:tca01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      655935 Ubiquitin system [BR:tca04121]  Ubiquitin ligases (E3)   UBL E3 ligases    655935   Multi subunit Ring-finger type E3    SCF complex     Ring finger protein      655935    Cul2 complex      655935    Cul3 complex      655935    Cul4 complex      655935    Cul7 complex      655935    Cul8 complex      655935    Cul9 complex      655935 DNA repair and recombination proteins [BR:tca03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       655935     TCR (transcription coupled repair) factors      Cul4-CSA complex       655935 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  655935 NCBI-ProteinID:  XP_967583 UniProt:  D2A2S1 LinkDB All DBs Position LG4:complement(11695278..11698034) Genome browser AA seq 113 aa AA seqDB search MAAAMDVDVDEVEVPTSSSSKGEKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIE CQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggcagcggcaatggacgtggatgttgacgaggtcgaagttcccacttcgagcagttcc aagggtgaaaagaagcgtttcgaagtgaaaaagtggaacgccgtagcgttgtgggcttgg gatatcgtggtcgataattgtgccatttgtcgcaatcatattatggatttatgtattgag tgtcaggcaaatcaggcctcagcgaccagtgaagagtgtacagttgcttggggagtgtgt aatcacgcgtttcattttcactgtatttcgaggtggttgaagacaaggcaggtgtgccca ctagataatcgagaatgggaatttcaaaagtatgggcattga

DBGET integrated database retrieval system