KEGG   Taeniopygia guttata (zebra finch): 100231557
Entry
100231557         CDS       T01082                                 

Definition
(RefSeq) interleukin-4
  KO
K05430  interleukin 4
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04060  Cytokine-cytokine receptor interaction
tgu04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100231557
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100231557
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tgu04052]
    100231557
   00536 Glycosaminoglycan binding proteins [BR:tgu00536]
    100231557
Cytokines and growth factors [BR:tgu04052]
 Cytokines
  Interleukins
   100231557
Glycosaminoglycan binding proteins [BR:tgu00536]
 Heparan sulfate / Haparin
  Cytokines
   100231557
SSDB
Motif
Pfam: IL4 IL13
Other DBs
NCBI-GeneID: 100231557
NCBI-ProteinID: XP_002188854
LinkDB
Position
13
AA seq 140 aa
MSILVQVLLTLLVLSACLGDVVAPWPQPLRTSILKESIKLLDQLQQMEVSCNKMNVINIF
ADHKRGNNTEILCKAATIAQEHQSCHGYLGGLYYNLLSLAWGSRARHKKPCPVAAGSTTS
LKNFLNDLHHVLQEEYKSQK
NT seq 423 nt   +upstreamnt  +downstreamnt
atgagtatcctggtgcaggtcctgctcaccctcctggtgctgtcagcctgcctgggagac
gtggtcgccccatggccacagccactacggaccagcatcctgaaggagagcatcaagctg
ctggaccagctccagcagatggaggtttcctgcaacaagatgaatgtgatcaatattttt
gcagatcataagagaggtaacaacacggagatcttatgcaaagctgccacaattgctcag
gagcaccagagctgccacgggtacctcgggggcctttactacaacttgctcagcctggcc
tgggggagcagagcaaggcacaagaagccatgtcccgtggcagcaggcagcaccacctca
ctgaagaacttcctcaatgatttacaccacgtcctccaagaagagtacaagagtcagaag
tga

DBGET integrated database retrieval system