KEGG   Tremella mesenterica: TREMEDRAFT_71046Help
Entry
TREMEDRAFT_71046  CDS       T03139                                 

Definition
(RefSeq) hypothetical protein
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
tms  Tremella mesenterica
Pathway
tms00562  Inositol phosphate metabolism
tms01100  Metabolic pathways
tms04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:tms00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    TREMEDRAFT_71046
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    TREMEDRAFT_71046
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tms01009]
    TREMEDRAFT_71046
Enzymes [BR:tms01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     TREMEDRAFT_71046
    3.1.3.48  protein-tyrosine-phosphatase
     TREMEDRAFT_71046
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     TREMEDRAFT_71046
Protein phosphatases and associated proteins [BR:tms01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    TREMEDRAFT_71046
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Y_phosphatase3 Y_phosphatase
Motif
Other DBs
NCBI-GeneID: 18498454
NCBI-ProteinID: XP_007003053
JGI: Treme1_71046
LinkDB All DBs
Position
Unknown
AA seq 556 aa AA seqDB search
MSFDYIRQVVSGNKARYVDRGSGVDLDLVYVTDRIIIMGYPAIGMAGLYRNRRRDVLKFI
NQRHGEKWWIWNLCPLYENAYSPESMHNRVSRYPFPDHHPPPLPLLPLAVKEMTAWLQGD
EERIAIIHCKAGKGRSGTLLCSYLLSLDTLPPPPQLPTSYSTHDPSRHSLVDRTEPGWIL
FGGGSSVAKAPVDQESDKEELRHDNDDREAHTEDPHTPARSERLRVTSRAGSTASSLTTI
SRPSPPPSVQISYLSEEPYAPMDIDDEGDLRRPGQRDRRDGKVDDVFRMHSSRRMKPTSS
GRGVSIPSQRRWCRYVNLLFTNKAPPSYLSPVRTRVRLISITMLLNPPTTWQKPLASLVV
GRSGGQGNAWASVARYDDDYVAELKRRGGSGEGIGGEITWGGVGGTGEWDTKKMFRSCGK
MVSAPTSQDSDDDECIKHELVPKSEPLVLERGREVRLKFHLASLPLGWTWFIPAFHLPEP
VPSTKTPIQQKVHTLHFDRSQIDFAIGPGASLRSVEVKLEEVPVDDMSEPARLLNDEEER
AEGVDERVEHVREDGE
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttgactacatacgtcaggtggtgtcggggaacaaggcgaggtatgtggatcgt
gggtccggtgtcgacctcgatttggtatatgtgacggataggatcatcattatgggatat
ccggctataggaatggctggactgtataggaaccgaagacgggacgtgttaaagtttatc
aatcagcggcatggcgagaagtggtggatctggaatctctgccccctctacgaaaatgcc
tactcgcccgagagcatgcacaatcgagtatcgcgatatccttttccagatcatcatcct
ccacccttgcctctactccctctggcggtcaaggaaatgacagcttggcttcaaggagat
gaagaaaggatagctatcatacattgtaaagcaggcaagggtcgatcgggtaccctcctc
tgctcttacctcctctcactagacacccttccccctccgccccaattacccacctcatat
tccactcacgaccccagtcgtcattcacttgtcgatcgcacagagccaggttggatccta
ttcggtggaggttcctcagtcgccaaagcgcctgtcgatcaagaatcagataaggaagag
ctgcgtcatgataacgacgatcgagaggcccacacagaggatcctcacacacctgcgaga
tcggagagactacgagtgacctccagggcaggatcgacagcttcatccttgacgactatc
tccaggccatcgccccctccctccgtccaaatatcatatctttcagaggaaccgtatgct
cccatggacatcgatgacgagggagatttgagacgaccagggcagagggacaggagagat
gggaaagttgacgacgtgttcagaatgcatagtagtaggaggatgaagcctacttcttcg
ggaagaggtgtttcaatcccgagtcaacgcagatggtgccgatacgtcaaccttctattc
accaacaaagctcctccatcctacctctcccccgttcgcacccgtgtccgtctcatctcc
atcaccatgctccttaacccacctactacttggcaaaaaccgttggcgtcgctcgtcgtc
ggacgctcaggtggacaagggaacgcatgggcatctgtggcgaggtacgacgatgattac
gtagcagaactgaagcgtcggggtgggagtggcgagggcattggaggggagatcacctgg
ggaggggtaggaggaaccggagagtgggacacgaagaagatgtttaggagttgtggaaag
atggtttctgcgcctacgtctcaggactcggacgacgacgaatgtataaaacacgaactt
gtacctaagtctgaaccactggttctcgaacgtggtagagaagtgcgactcaaatttcat
ttagcttcattacctctaggatggacctggttcattcccgcctttcacctccctgaacct
gtgccctccaccaaaacaccaatccaacaaaaagtccacacattacatttcgacagatcg
caaattgatttcgccatcggaccaggagcttctttgagaagtgtggaggtgaaattagag
gaggtaccagtggatgacatgtcagagcctgcgaggttgttgaatgatgaggaagagcgc
gctgaaggggtggatgagagagtggaacatgtcagagaagacggggaatga

DBGET integrated database retrieval system