KEGG   Trichechus manatus latirostris (Florida manatee): 101341729Help
Entry
101341729         CDS       T05135                                 

Definition
(RefSeq) angiotensin-converting enzyme-like protein Ace3
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04614  Renin-angiotensin system
tmu04924  Renin secretion
tmu05142  Chagas disease (American trypanosomiasis)
tmu05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    101341729
   04614 Renin-angiotensin system
    101341729
 09160 Human Diseases
  09166 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    101341729
  09174 Infectious diseases: Parasitic
   05142 Chagas disease (American trypanosomiasis)
    101341729
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tmu01002]
    101341729
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tmu04147]
    101341729
   04090 CD molecules [BR:tmu04090]
    101341729
Enzymes [BR:tmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     101341729
Peptidases [BR:tmu01002]
 Metallo Peptidases
  Family M2
   101341729
Exosome [BR:tmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101341729
CD molecules [BR:tmu04090]
 Proteins
  101341729
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 101341729
NCBI-ProteinID: XP_004374491
UniProt: A0A2Y9DGY0
LinkDB All DBs
Position
Unknown
AA seq 701 aa AA seqDB search
MSYNESEVKAFLQNYERTAQVVWNKFMEATWNYVTNITKKNRGEMLHEDMERSQHILFFG
TQARLFNIATFQDPVIKRMLRKMQNMGKAALPVKELQEYNQLLAYMETMYSMAQVCLEEG
PCLYLEPDLQEVMANSRDQKELLWAWQGWRDAVGRPLRTFFERYVQLSNKAANLNGYKDM
GALWRSKYDSENETNTLQHDLELLFQELQPLYLNLHAYVRRALHRRYGPQFIDLKGPIPA
HLLGDMWAQSWVNILDLVLPFPEKPLEDITKIMKGQRWKPHKMFQEAEKFFTSLGLLPTP
MEFWSKSMLEKPADGREVMCHASAWDFYNGHDFRIKRCTEVTIEDLLSVFHQMGHIQYFL
QYKDLSVIFREGANPAFEEAVGSAITLSASSHKYLLNIGLLSLQFQDSKDEVNFLMGIAL
EKIAFIPFGYLVDLYRWKVFDGTIHKNIYNQEWWSLRLKYQGLCPPVPRSEEDFDPGAKY
HISASIPYLRYFLSVVLQFQLHEALCRASGHVGPLHHCNIYNSKMAGKLLEDALKLGSSK
PWPEVLKMMTGESQVSTKALMTYFKPLMNWLVTENVRQGEVLGWPEFSCSFEEKEKNTFL
GLELDSDQAKTGQWVLLVLSFVMFLLVLMLGRRLYILSTAQDTKAYFLGMAMEPHKAAKG
QWILLGLCVLLLVCSISLAIKIFTQQSKKPLWMTAEWWGLN
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgtcctacaatgagagtgaagtaaaggcattcctgcagaattatgaacgaacagcccag
gttgtatggaacaagtttatggaggccacctggaactatgtcaccaacatcaccaagaaa
aaccgaggagagatgctgcatgaggacatggagaggtcccagcatatcctgttttttggc
acccaagcccgcctgtttaacatcgccacattccaggacccagtcataaagcgcatgctg
agaaagatgcaaaacatgggcaaggcggccctgcctgtgaaagagctccaggagtacaac
cagctcctggcctacatggagacaatgtacagtatggcccaggtgtgcctggaagaggga
ccctgcctgtacctggagcctgacctccaagaagtaatggccaactcccgggaccagaaa
gagctgctgtgggcatggcagggctggcgggatgctgtgggccgcccactacgcaccttc
tttgagcgctacgtgcagctcagcaacaaagctgcgaatctcaatggttacaaagacatg
ggggccttgtggcgctcaaaatacgactctgagaacgagaccaacaccctgcaacatgac
ctggagctgctgttccaggagcttcagccactctacctgaacctgcacgcctatgtgcgc
cgcgccctgcaccgccgctacgggccccagttcatcgacctgaaggggcctatccctgcc
cacctcctgggggacatgtgggctcagtcctgggtcaacatcttagacctggtcttgccc
ttcccggagaaacccctggaggacatcacgaagatcatgaaaggccagcgctggaagccc
cacaaaatgttccaagaggctgaaaaattcttcacctccctggggctactgcccaccccg
atggagttctggagcaagtctatgttggagaagccagctgatggacgggaggtgatgtgc
catgcctctgcctgggacttctacaatggccatgacttcaggataaagaggtgtaccgag
gtgaccatagaagacctgctctccgtcttccaccagatgggccatattcagtacttctta
cagtacaaggacctttctgtgatcttccgtgaaggtgccaacccagcctttgaagaggct
gtggggtcagcgatcaccctctcggcctcctctcacaagtacctgctcaacataggcctg
ctcagcttacagttccaggactcaaaggatgaggtcaatttcctgatgggcattgctctt
gagaagattgccttcatcccctttggctacctggtggacctgtaccgctggaaggtcttt
gatggcaccatccataagaacatctacaaccaggagtggtggagcctcaggttgaagtac
cagggcctgtgcccccccgttcctcggtcagaagaggactttgatccaggtgccaagtac
cacatttccgccagcatcccctacttaaggtacttcctcagtgtggtgctccagttccag
ctccatgaagcactgtgcagggcctcgggccacgtgggtccgctgcaccactgtaacatc
tataactccaagatggctgggaagctcctagaggatgctctaaagctgggttcaagcaag
ccctggccagaagtcctgaagatgatgaccggggagtcccaggtgtctacgaaggccctc
atgacctacttcaagcccctgatgaactggctggtcaccgagaacgtgcggcagggggag
gtcctgggctggccagaattcagctgttcctttgaagaaaaggagaagaacacattcctg
gggctggagctggacagtgaccaggccaagacaggacaatgggtgctgctggtcctgagc
tttgtcatgttcctcttggtcctaatgctgggccgcaggctgtacatcctgtcaacagcc
caggacactaaggcctacttcctgggcatggctatggagccccacaaggctgccaagggc
cagtggatattgctgggcctctgcgtcctcctgctggtgtgctcaatcagcctggccatc
aagattttcacacagcagagcaagaagcctctgtggatgacagctgagtggtggggcctg
aactag

DBGET integrated database retrieval system