KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00000890G001
Entry
GSTEN00000890G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K04735  transcription factor p65
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04010  MAPK signaling pathway
tng04137  Mitophagy - animal
tng04210  Apoptosis
tng04218  Cellular senescence
tng04620  Toll-like receptor signaling pathway
tng04621  NOD-like receptor signaling pathway
tng04622  RIG-I-like receptor signaling pathway
tng04623  Cytosolic DNA-sensing pathway
tng04625  C-type lectin receptor signaling pathway
tng04920  Adipocytokine signaling pathway
tng05132  Salmonella infection
tng05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    GSTEN00000890G001
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    GSTEN00000890G001
  09143 Cell growth and death
   04210 Apoptosis
    GSTEN00000890G001
   04218 Cellular senescence
    GSTEN00000890G001
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    GSTEN00000890G001
   04621 NOD-like receptor signaling pathway
    GSTEN00000890G001
   04622 RIG-I-like receptor signaling pathway
    GSTEN00000890G001
   04623 Cytosolic DNA-sensing pathway
    GSTEN00000890G001
   04625 C-type lectin receptor signaling pathway
    GSTEN00000890G001
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    GSTEN00000890G001
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    GSTEN00000890G001
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    GSTEN00000890G001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tng03000]
    GSTEN00000890G001
Transcription factors [BR:tng03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    GSTEN00000890G001
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-ProteinID: CAF87862
UniProt: Q4TGX0
LinkDB
Position
undetermined
AA seq 289 aa
GYGWSLGSLGAGKTPPPVRSALCCRGDGGRRLTRALVSAHRALPGDHRAAQAEGHALPLQ
VRGPLGRQHPRREEQRHHQDASGRQGAQLQRAAARAHLPGDQERPLQAPPPRAGGEGLQT
RLLRGRPAGEEGPQSRRLLVRRPSLWLGESFPNLGIQCVKKKDVSEAITCRLQTGNNPFS
IPEAKVWEEEFDLNSVRLCFQASFTQASGQRLQWRPWCRSPSTTTQVERCHGNSPGAQRV
QELGFRLQGPGSSAGAPNTAELKICRVNRNSGSCKGGDEIFLLCDKVQK
NT seq 868 nt   +upstreamnt  +downstreamnt
gggtacgggtggagcctgggctcgctgggcgcaggtaagacgccgcctccggtccgcagc
gctctctgttgccgtggcgacggcggccgccggctgacccgagctctggtgtccgcgcac
cgggcccttcctggagatcatcgagcagcccaagcagaggggcatgcgcttccgctacaa
gtgcgagggccgctcggccggcagcatccccggcgagaagagcaacgacaccaccaagac
gcatccggccgtcaaggtgcacaactacagcgggccgctgcgcgtgcgcatctccctggt
gaccaagaacgccccctacaagccccacccccacgagctggtggggaaggactgcaaaca
cggctactacgaggccgacctgcaggagaggagggtccacagagccgccggctgctggtc
aggaggccttcgctgtggctgggagaaagcttccccaacctgggcatccagtgtgtgaag
aagaaggacgtgagcgaggccatcacctgcaggctgcagacgggcaacaaccccttcagc
attccggaggccaaggtgtgggaggaggagtttgacctcaactcggtgcgcctctgcttc
caggcctccttcacgcaggcctcaggccagcgcctgcagtggcgcccgtggtgtcgcagc
ccatctacgacaacccaggttgagcgttgccatggcaacagccctggagcccagagggtc
caggaactagggtttaggctccagggaccagggtcctcagcaggggctcccaacacggcc
gagctgaagatctgcagggtcaaccgcaactctgggagctgcaaggggggcgacgagatc
ttcctgctgtgtgacaaggtgcagaaag

DBGET integrated database retrieval system