KEGG   Tetrapisispora phaffii: TPHA_0G03730Help
Entry
TPHA_0G03730      CDS       T02235                                 

Gene name
TPHA0G03730
Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
tpf  Tetrapisispora phaffii
Pathway
tpf00010  Glycolysis / Gluconeogenesis
tpf00051  Fructose and mannose metabolism
tpf00052  Galactose metabolism
tpf00500  Starch and sucrose metabolism
tpf00520  Amino sugar and nucleotide sugar metabolism
tpf01100  Metabolic pathways
tpf01110  Biosynthesis of secondary metabolites
tpf01130  Biosynthesis of antibiotics
tpf01200  Carbon metabolism
Module
tpf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tpf_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TPHA_0G03730 (TPHA0G03730)
   00051 Fructose and mannose metabolism
    TPHA_0G03730 (TPHA0G03730)
   00052 Galactose metabolism
    TPHA_0G03730 (TPHA0G03730)
   00500 Starch and sucrose metabolism
    TPHA_0G03730 (TPHA0G03730)
   00520 Amino sugar and nucleotide sugar metabolism
    TPHA_0G03730 (TPHA0G03730)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    TPHA_0G03730 (TPHA0G03730)
Enzymes [BR:tpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     TPHA_0G03730 (TPHA0G03730)
Membrane trafficking [BR:tpf04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    TPHA_0G03730 (TPHA0G03730)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 FGGY_N
Motif
Other DBs
NCBI-GeneID: 11535753
NCBI-ProteinID: XP_003686647
UniProt: G8BWD5
LinkDB All DBs
Position
7:complement(790753..792213)
Genome map
AA seq 486 aa AA seqDB search
MVHLGPKKPPARKGSMIDMPKELKDDLQAIVSSFDVSTETLHAVVKHFITELDKGLSKKG
GNIPMIPGWVLEYPTGKESGDFLAIDLGGTNLRVVLVELGGDRTFDTTQSKYKIPTAMRT
TQDPEELWAFIADSLDSFVKERFPEGVDKPLPLGFTFSYPASQERINSGVLQRWTKGFDI
PDTEGRDVVTLLRKQLEIRKTPIEVVALINDTTGTLVASLYTDGETKMGVIFGTGVNGAY
YDKVSGIEKLEGRLASDITPDMPMAINCEYGSFDNEHVVLPRNKYDIQIDNESPRPGQQA
FEKMSSGYYLGELVRLSLLDLYNQGHIFKGQDVTKLKTPYVMDTSFPSKIEDDPFENLEN
TDELFQNELNIQTTASEREIIRRICEAVGVRAARVSACGIAAICQKMGYETGHIAADGSV
FNLYPGFKERVHAALKDIYGWKEESDYKKYPIVVVPAEDGSGAGAAIIAALTQKRLAAGK
SVGVSN
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggttcacttaggtccaaaaaagccacctgctagaaaaggttcaatgattgacatgcca
aaggaattgaaagatgacttacaagccatcgtttcttctttcgacgtctcaaccgaaact
ctacatgctgttgtcaagcactttattaccgagttagacaaaggtctatccaagaaaggg
ggtaacattccaatgattccaggttgggttttggaatacccaactggtaaggaaagtggt
gacttcttagccattgatttaggtggtaccaacttaagagtcgttttagttgaattaggt
ggtgacagaacttttgacactactcaatccaagtataagattccaactgctatgagaacc
actcaagaccctgaagaattatgggctttcattgctgattctttagactcttttgttaag
gaaagattcccagaaggcgtcgacaagccattaccattaggtttcactttctcttaccca
gcttctcaagaaagaattaactctggtgttttacaaagatggaccaagggtttcgatatt
ccagacactgaaggtcgcgatgttgtcaccttattacgtaaacaattagaaattagaaag
actccaattgaagttgttgctttaattaacgatactactggtactttagtcgcttcccta
tacactgatggtgaaactaagatgggtgttattttcggtactggtgtcaacggtgcctac
tacgacaaagtcagcggtattgaaaagttagaaggtagattagcttccgatattactcca
gatatgccaatggctattaactgtgaatatggttctttcgataacgaacatgttgtatta
ccaagaaacaagtatgatatccaaattgataatgaatctccaagaccaggtcaacaagct
ttcgaaaagatgtcttctggttattacttaggtgaattagttcgtttatctttattagac
ttatacaaccaaggtcatattttcaagggtcaagatgttaccaagttaaagactccatac
gttatggatacctctttcccatctaagattgaagatgatccatttgaaaacttagaaaac
actgatgaattattccaaaatgaattaaacattcaaactaccgcctctgaacgtgaaatc
atcagaagaatctgtgaagctgttggtgttagagctgccagagtttccgcttgtggtatc
gctgctatctgccaaaagatgggttacgaaactggtcatattgctgctgatggttccgtt
ttcaacttatacccaggtttcaaggaaagagtccatgctgccttaaaggacatctacgga
tggaaggaagaatccgactacaagaagtatccaattgttgttgtcccagctgaagatggt
tctggtgctggtgctgccattattgctgctttaactcaaaagagattagctgctggtaaa
tctgttggtgtttctaactaa

DBGET integrated database retrieval system