KEGG   Thamnophis sirtalis: 106547400
Entry
106547400         CDS       T06107                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
tsr  Thamnophis sirtalis
Pathway
tsr04012  ErbB signaling pathway
tsr04068  FoxO signaling pathway
tsr04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106547400 (CDKN1B)
   04068 FoxO signaling pathway
    106547400 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106547400 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 106547400
NCBI-ProteinID: XP_013920022
UniProt: A0A6I9XZX9
LinkDB
Position
Unknown
AA seq 265 aa
MRGSGRQGCCALSAREALPRLGPAERPPAVAVVAAAFSSSPSGTPSPSPAAASAPWPAAR
RAMSKVRVSNGSPTLERMEGRPADGPKPSACRCLFGPVDRQELAREWQEQSRHLEEAGRR
RWNFDFRREHPLEGRFEWQALDRAALPDFYSRPPRLGGARPKADARERRLELNGDRSPSR
GLRCAQAPAEEQEPEPESQQQDGAPLTLSFGPRKRPAADDSSPQSKRANTIEEISEEHCG
EPPMASSEEQTPKKKTTSSPKRCQT
NT seq 798 nt   +upstreamnt  +downstreamnt
atgcgaggctccggccggcagggttgctgcgcgctgtccgcccgggaagcgctccctcgg
ctgggtccagcggaaaggccgcccgccgtcgccgtcgtcgccgccgccttctcctcttcc
ccgagcgggacgccgagcccctcacccgccgccgcctcagcgccgtggccggctgcgcgg
cgggccatgtcgaaagtgcgtgtctcgaatgggagcccgaccctggagcggatggaaggc
cggccggcggatggccccaagccctcggcgtgccgctgcctcttcggccccgtcgaccgg
caggagctggcgcgcgagtggcaggagcagagccgccacctggaagaggccggccggagg
cggtggaacttcgactttcggcgcgagcatcccctggagggccgcttcgagtggcaggcg
ctggatagggcggcgctgcccgacttctacagccgacccccgcgactcggcggggcccgg
cccaaagctgacgcccgggagcggcgcctggagctcaacggagaccgctcgccgtctagg
gggctgcgctgcgctcaggcaccggccgaagagcaggagcccgaaccggagtcccagcag
caggacggggccccgctaacccttagcttcggcccgaggaagcgacctgccgccgatgat
tcctctcctcaaagcaaaagagccaacacaattgaagaaatctccgaagagcattgcggg
gagccacccatggccagctcagaggaacaaacgcccaagaagaagaccacatccagtccg
aagcggtgtcaaacgtaa

DBGET integrated database retrieval system