KEGG   Tupaia chinensis (Chinese tree shrew): 102470940
Entry
102470940         CDS       T02978                                 

Gene name
CASP9, Caspase-9
Definition
(RefSeq) caspase 9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01524  Platinum drug resistance
tup04115  p53 signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04210  Apoptosis
tup04215  Apoptosis - multiple species
tup04370  VEGF signaling pathway
tup04919  Thyroid hormone signaling pathway
tup05010  Alzheimer disease
tup05012  Parkinson disease
tup05014  Amyotrophic lateral sclerosis
tup05016  Huntington disease
tup05020  Prion disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05134  Legionellosis
tup05145  Toxoplasmosis
tup05152  Tuberculosis
tup05160  Hepatitis C
tup05161  Hepatitis B
tup05162  Measles
tup05163  Human cytomegalovirus infection
tup05164  Influenza A
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05168  Herpes simplex virus 1 infection
tup05169  Epstein-Barr virus infection
tup05170  Human immunodeficiency virus 1 infection
tup05200  Pathways in cancer
tup05210  Colorectal cancer
tup05212  Pancreatic cancer
tup05213  Endometrial cancer
tup05215  Prostate cancer
tup05222  Small cell lung cancer
tup05223  Non-small cell lung cancer
tup05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    102470940 (CASP9)
   04151 PI3K-Akt signaling pathway
    102470940 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102470940 (CASP9)
   04215 Apoptosis - multiple species
    102470940 (CASP9)
   04115 p53 signaling pathway
    102470940 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102470940 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102470940 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102470940 (CASP9)
   05212 Pancreatic cancer
    102470940 (CASP9)
   05215 Prostate cancer
    102470940 (CASP9)
   05213 Endometrial cancer
    102470940 (CASP9)
   05222 Small cell lung cancer
    102470940 (CASP9)
   05223 Non-small cell lung cancer
    102470940 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102470940 (CASP9)
   05012 Parkinson disease
    102470940 (CASP9)
   05014 Amyotrophic lateral sclerosis
    102470940 (CASP9)
   05016 Huntington disease
    102470940 (CASP9)
   05020 Prion disease
    102470940 (CASP9)
   05022 Pathways of neurodegeneration - multiple diseases
    102470940 (CASP9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102470940 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    102470940 (CASP9)
   05152 Tuberculosis
    102470940 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102470940 (CASP9)
   05161 Hepatitis B
    102470940 (CASP9)
   05160 Hepatitis C
    102470940 (CASP9)
   05164 Influenza A
    102470940 (CASP9)
   05162 Measles
    102470940 (CASP9)
   05168 Herpes simplex virus 1 infection
    102470940 (CASP9)
   05163 Human cytomegalovirus infection
    102470940 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102470940 (CASP9)
   05169 Epstein-Barr virus infection
    102470940 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102470940 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102470940 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tup01009]
    102470940 (CASP9)
   01002 Peptidases and inhibitors [BR:tup01002]
    102470940 (CASP9)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     102470940 (CASP9)
Protein phosphatases and associated proteins [BR:tup01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102470940 (CASP9)
Peptidases and inhibitors [BR:tup01002]
 Cysteine peptidases
  Family C14: caspase family
   102470940 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 102470940
NCBI-ProteinID: XP_014442046
LinkDB
Position
Un
AA seq 446 aa
MDEADRQLLRRCRVRLVSDLQVAPLWDALLNRELFTPNMIEDIQQAGSGSRGDQARQLVT
DLETRGSQALPLFISCLEDTGQDSLASLLRTSRQAAKRDPEAIRSLDLVSVELKPEELRG
VKHPSKPTQGNLTPVVLGPEELWPPKLRPEVLRPEVSRPVDVGPGGFGDGCAQGSSRGNA
DLAYVLDADPCGYCLVINNVNFCPESGLGSRTGSNVDCEKVQRRFRLLHFMVEVQCDLTA
KKMLQALVQLAQRDHGALDCCVVVILSHGSQVSHFQFPGAVYGTDGCLVSVEKIVNIFNG
TSCPSLRGKPKVFFIQACGGEKKDPGFEVASTAPEDSASGSNPEPDAAPFQEGPRTFDQP
DAVSSLPTPSDIFVSYSTFPGFVSWRNTTSGSWYIETLDGVFEQWAHSEDLQSLLLRVAD
AVSVKGIYKQMPGCFNFLRKKLFFKT
NT seq 1341 nt   +upstreamnt  +downstreamnt
atggacgaagctgaccggcagcttctgcggcggtgccgggtgcggctggtgagcgatttg
caggtggccccactctgggacgctctgctgaaccgcgagctgttcacgccgaacatgatc
gaggacatccagcaggcaggctctgggtctcggggcgatcaggccaggcaactggtcaca
gatctagagacccgagggagtcaggcccttcctctgttcatctcctgcctggaggacaca
ggccaggactctctggcttcactcctacgaacgagtaggcaagcagcaaagcgggatccg
gaggccatcagatccctggaccttgtgtctgtggaactcaaaccagaagaactgagaggg
gtgaagcatccatcaaagccaacccagggaaacctcaccccagtggtgctggggcccgag
gagctctggccccccaagctcagaccggaggttctcagaccagaagtctctaggccagtg
gatgttggtcctggaggattcggtgatggctgtgctcaggggagctcaaggggaaatgca
gacttggcgtacgtcctggacgcggacccttgtggctactgcctggtcatcaacaacgtg
aacttctgccccgagtcagggctcggctcccgcaccggctccaacgtggactgtgagaag
gtgcagcgccgcttccgcctgctgcacttcatggtcgaggtgcagtgcgacctgaccgcc
aagaaaatgctccaggctctggtgcagctggcacagcgggaccacggcgctctggactgc
tgcgtggtggtcatcctctcccacggcagtcaggtcagccatttccagttcccgggggcc
gtctatggcacagatgggtgtcttgtgtctgttgagaaaatcgtgaacatcttcaatggg
accagctgccccagcctcagaggaaagcccaaggtgtttttcatccaggcatgcggtggg
gagaagaaagaccctggatttgaggtggcctccacggcccccgaagactcggcctctggc
agtaaccctgaaccagatgctgccccgttccaggaaggccccaggaccttcgaccagccg
gacgccgtgtctagtttgcccacacccagtgacatctttgtgtcctactccaccttccca
ggcttcgtgtcctggaggaacaccacgagcggctcctggtacattgagaccctggacggc
gtctttgagcagtgggctcactccgaggacctccaatccctgctgctcagggtcgctgat
gctgtgtcggtgaaagggatttacaaacagatgcctggttgttttaacttcctccggaag
aagctcttctttaaaacttaa

DBGET integrated database retrieval system